|
LmxM.01.0610 | LmxM.01.0610.1 | 1 | 1 | 1 | | | forward | protein coding | No | 732 | LmxM.01.0610 | DNA-damage inducible protein DDI1-like protein | DNA-damage inducible protein DDI1-like protein | | E9AJE8 | 1 | LmxM.01:171,360..172,091(+) | LmxM.01:171360..172091(+) | LmxM.01 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_101685 | 0 | 243 | 732 | 26969 | 4.51 | 0 | | | | | GO:0004190 | aspartic-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005654 | nucleoplasm | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.01.0610ORDNA-damage inducible protein DDI1-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.01.0610 OR DNA-damage inducible protein DDI1-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.01.0650 | LmxM.01.0650.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1485 | LmxM.01.0650 | mitochondrial-processing peptidase subunit beta, putative | mitochondrial-processing peptidase subunit beta, putative | | E9AJF2 | 1 | LmxM.01:184,245..185,729(+) | LmxM.01:184245..185729(+) | LmxM.01 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_100777 | 0 | 494 | 1485 | 55164 | 6.51 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0020023;GO:0017087;GO:0005739 | kinetoplast;mitochondrial processing peptidase complex;mitochondrion | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.01.0650ORmitochondrial-processing peptidase subunit beta, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.01.0650 OR mitochondrial-processing peptidase subunit beta, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.02.0040 | LmxM.02.0040.1 | 1 | 1 | 1 | | | reverse | protein coding | Yes | 1854 | LmxM.02.0040 | Xaa-Pro aminopeptidase, putative | Xaa-Pro aminopeptidase, putative | | | 2 | LmxM.02:1,523..3,376(-) | LmxM.02:1523..3376(-) | LmxM.02 | Leishmania mexicana MHOM/GT/2001/U1103 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 617 | 1854 | 68390 | 6.08 | 0 | NN: MKASGAAVLHAVREKMKEATVTALIVPSSDAH, HMM: MKASGAAVLHAVREKMKEATVTALIVPSSDAH | NN Sum: 1, NN D: .13, HMM Prob: .57 | | | GO:0016787 | hydrolase activity | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.02.0040ORXaa-Pro aminopeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.02.0040 OR Xaa-Pro aminopeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.02.0710 | LmxM.02.0710.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2454 | LmxM.02.0710 | serine peptidase, putative | serine peptidase, putative | | E9AJN3 | 2 | LmxM.02:286,574..289,027(+) | LmxM.02:286574..289027(+) | LmxM.02 | Leishmania mexicana MHOM/GT/2001/U1103 | 141 | OG6_100223 | 1 | 817 | 2454 | 90965 | 7.43 | 0 | NN: MMRRHLTQASTALRCGSTAAPAA, HMM: MMRRHLTQASTALRCGSTAAPAARVASFMCGGTRKAPVAAVACSPLALSTAA | NN Sum: 0, NN D: .25, HMM Prob: .99 | | | GO:0005524 | ATP binding | | | GO:0005739 | mitochondrion | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.02.0710ORserine peptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.02.0710 OR serine peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.02.0740 | LmxM.02.0740.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2037 | LmxM.02.0740 | peptidyl dipeptidase, putative | peptidyl dipeptidase, putative | | E9AJN6 | 2 | LmxM.02:292,757..294,793(+) | LmxM.02:292757..294793(+) | LmxM.02 | Leishmania mexicana MHOM/GT/2001/U1103 | 118 | OG6_100561 | 2 | 678 | 2037 | 76626 | 5.83 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.02.0740ORpeptidyl dipeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.02.0740 OR peptidyl dipeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.03.0540 | LmxM.03.0540.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1191 | LmxM.03.0540 | serine peptidase, Clan SJ, family S16, putative | serine peptidase, Clan SJ, family S16, putative | | E9AJT7 | 3 | LmxM.03:193,496..194,686(+) | LmxM.03:193496..194686(+) | LmxM.03 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_101751 | 0 | 396 | 1191 | 44500 | 9.15 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.03.0540ORserine peptidase, Clan SJ, family S16, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.03.0540 OR serine peptidase, Clan SJ, family S16, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.04.0450 | LmxM.04.0450.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2394 | LmxM.04.0450 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9AK26 | 4 | LmxM.04:157,065..159,458(-) | LmxM.04:157065..159458(-) | LmxM.04 | Leishmania mexicana MHOM/GT/2001/U1103 | 136 | OG6_127587 | 2 | 797 | 2394 | 88701 | 4.70 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.04.0450ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.04.0450 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.04.0850 | LmxM.04.0850.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1083 | LmxM.04.0850 | serine peptidase, Clan S-, family S54, putative | serine peptidase, Clan S-, family S54, putative | | E9AK68 | 4 | LmxM.04:311,935..313,017(-) | LmxM.04:311935..313017(-) | LmxM.04 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_147170 | 0 | 360 | 1083 | 39603 | 7.18 | 4 | HMM: MRCAMSSSSSSTSTSSSGLLTVRASAAAMHALHSGSLSVSSTLPTSLTAL, NN: MRCAMSSSSSSTSTSSSGLLTVRASAAA | NN Sum: 0, NN D: .17, HMM Prob: .95 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | GO:0031966 | mitochondrial membrane | | | GO:0030150 | protein import into mitochondrial matrix | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.04.0850ORserine peptidase, Clan S-, family S54, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.04.0850 OR serine peptidase, Clan S-, family S54, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.05.0950 | LmxM.05.0950.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2727 | LmxM.05.0950 | glutaminyl cyclase, putative | glutaminyl cyclase, putative | | E9AKK1 | 5 | LmxM.05:355,050..357,776(+) | LmxM.05:355050..357776(+) | LmxM.05 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_151075 | 0 | 908 | 2727 | 102047 | 8.42 | 1 | | | | | | | | | | | | | | | | 2.3.2.5 (Glutaminyl-peptide cyclotransferase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.05.0950ORglutaminyl cyclase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.05.0950 OR glutaminyl cyclase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.05.0960 | LmxM.05.0960.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2040 | LmxM.05.0960 | metallo-peptidase, Clan M-, Family M49 | metallo-peptidase, Clan M-, Family M49 | | E9AKK2 | 5 | LmxM.05:358,745..360,784(+) | LmxM.05:358745..360784(+) | LmxM.05 | Leishmania mexicana MHOM/GT/2001/U1103 | 28 | OG6_103290 | 0 | 679 | 2040 | 75732 | 5.44 | 0 | | | GO:0005737 | cytoplasm | GO:0008239 | dipeptidyl-peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.4 (Dipeptidyl-peptidase III) | 3.4.14.4 (Dipeptidyl-peptidase III) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.05.0960ORmetallo-peptidase, Clan M-, Family M49ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.05.0960 OR metallo-peptidase, Clan M-, Family M49 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.06.0140 | LmxM.06.0140.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 744 | LmxM.06.0140 | proteasome beta 6 subunit, putative | proteasome beta 6 subunit, putative | | E9AKP2 | 6 | LmxM.06:53,128..53,871(-) | LmxM.06:53128..53871(-) | LmxM.06 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_101631 | 0 | 247 | 744 | 27909 | 6.87 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.06.0140ORproteasome beta 6 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.06.0140 OR proteasome beta 6 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.06.0340 | LmxM.06.0340.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2718 | LmxM.06.0340 | serine peptidase, clan SC, family S9A-like protein | serine peptidase, clan SC, family S9A-like protein | | E9AKR2 | 6 | LmxM.06:114,598..117,315(-) | LmxM.06:114598..117315(-) | LmxM.06 | Leishmania mexicana MHOM/GT/2001/U1103 | 107 | OG6_102873 | 1 | 905 | 2718 | 103874 | 6.13 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.06.0340ORserine peptidase, clan SC, family S9A-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.06.0340 OR serine peptidase, clan SC, family S9A-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.07.0030 | LmxM.07.0030.1 | 1 | 1 | 1 | | | forward | protein coding | No | 456 | LmxM.07.0030 | hypothetical protein, conserved | hypothetical protein, conserved | | E9AL13 | 7 | LmxM.07:14,775..15,230(+) | LmxM.07:14775..15230(+) | LmxM.07 | Leishmania mexicana MHOM/GT/2001/U1103 | 13 | OG6_478828 | 0 | 151 | 456 | 16710 | 6.60 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.07.0030ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.07.0030 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.07.0100 | LmxM.07.0100.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3099 | LmxM.07.0100 | pitrilysin-like metalloprotease | pitrilysin-like metalloprotease | | E9AL20 | 7 | LmxM.07:35,081..38,179(+) | LmxM.07:35081..38179(+) | LmxM.07 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_101809 | 0 | 1032 | 3099 | 115443 | 6.24 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.07.0100ORpitrilysin-like metalloproteaseANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.07.0100 OR pitrilysin-like metalloprotease AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.07.0270 | LmxM.07.0270.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1194 | LmxM.07.0270 | acetylornithine deacetylase-like protein | acetylornithine deacetylase-like protein | | E9AL37 | 7 | LmxM.07:103,188..104,381(-) | LmxM.07:103188..104381(-) | LmxM.07 | Leishmania mexicana MHOM/GT/2001/U1103 | 698 | OG6_100626 | 0 | 397 | 1194 | 42917 | 6.01 | 0 | | | GO:0005737 | cytoplasm | GO:0008777;GO:0016787 | acetylornithine deacetylase activity;hydrolase activity | GO:0006526;GO:0008152 | arginine biosynthetic process;metabolic process | | | | | | | 3.5.1.16 (Acetylornithine deacetylase) | 3.5.1.16 (Acetylornithine deacetylase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.07.0270ORacetylornithine deacetylase-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.07.0270 OR acetylornithine deacetylase-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.07.0370 | LmxM.07.0370.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2760 | LmxM.07.0370 | Zinc finger, C3HC4 type (RING finger), putative | Zinc finger, C3HC4 type (RING finger), putative | | E9AL48 | 7 | LmxM.07:161,640..164,399(-) | LmxM.07:161640..164399(-) | LmxM.07 | Leishmania mexicana MHOM/GT/2001/U1103 | 22 | OG6_166659 | 0 | 919 | 2760 | 96521 | 8.04 | 0 | | | | | GO:0046872;GO:0005515;GO:0008270 | metal ion binding;protein binding;zinc ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.07.0370ORZinc finger, C3HC4 type (RING finger), putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.07.0370 OR Zinc finger, C3HC4 type (RING finger), putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.07.1120 | LmxM.07.1120.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1038 | LmxM.07.1120 | proteasome regulatory non-ATP-ase subunit, putative | proteasome regulatory non-ATP-ase subunit, putative | | E9ALD1 | 7 | LmxM.07:538,622..539,659(+) | LmxM.07:538622..539659(+) | LmxM.07 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_102002 | 0 | 345 | 1038 | 36487 | 4.10 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0005654;GO:0000502;GO:0005838 | ciliary plasm;cytoplasm;nucleoplasm;proteasome complex;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.07.1120ORproteasome regulatory non-ATP-ase subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.07.1120 OR proteasome regulatory non-ATP-ase subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.0230 | LmxM.08.0230.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1569 | LmxM.08.0230 | ABC1 family, putative | ABC1 family, putative | | E9AMA2 | 8 | LmxM.08:1,243,094..1,244,662(+) | LmxM.08:1243094..1244662(+) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 108 | OG6_100510 | 1 | 522 | 1569 | 58704 | 7.34 | 0 | NN: MTFRFSRAARYGAAAAGFMGAGTAA, HMM: MTFRFSRAARYGAAAAGFMGAGTAAI | NN Sum: 2, NN D: .36, HMM Prob: .87 | | | | | | | | | | | | | | 2.7.-.- (Transferring phosphorus-containing groups.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.0230ORABC1 family, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.0230 OR ABC1 family, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.0450 | LmxM.08.0450.1 | 1 | 1 | 1 | | | forward | protein coding | No | 543 | LmxM.08.0450 | signal peptidase type I, putative | signal peptidase type I, putative | | E9AMC4 | 8 | LmxM.08:1,338,321..1,338,863(+) | LmxM.08:1338321..1338863(+) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_100807 | 0 | 180 | 543 | 20634 | 6.86 | 2 | NN: MREHIDTLLSLRIRDVVHQVVTISLFLSVILVGWRGAA, HMM: MREHIDTLLSLRIRDVVHQVVTISLFLSVILVGWRGAA | NN Sum: 3, NN D: .44, HMM Prob: .03 | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.0450ORsignal peptidase type I, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.0450 OR signal peptidase type I, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1030a | LmxM.08.1030a.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1602 | LmxM.08.1030a | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_57:1,621..3,222(-) | 1036_mexFOS1_13k16.p1kpIBF_57:1621..3222(-) | 1036_mexFOS1_13k16.p1kpIBF_57 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 533 | 1602 | 57519 | 7.30 | 1 | NN: MHRCCVRLPAPALLPVMTSL, HMM: MHRCCVRLPAPALLPVMTSLPLLHSP | NN Sum: 2, NN D: .49, HMM Prob: .76 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1030aORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1030a OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1040 | LmxM.08.1040.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1512 | LmxM.08.1040 | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_41:2,043..3,554(-) | 1036_mexFOS1_13k16.p1kpIBF_41:2043..3554(-) | 1036_mexFOS1_13k16.p1kpIBF_41 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 503 | 1512 | 54206 | 6.87 | 1 | | | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1040ORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1040 OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1040a | LmxM.08.1040a.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 267 | LmxM.08.1040a | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_57:3..269(-) | 1036_mexFOS1_13k16.p1kpIBF_57:3..269(-) | 1036_mexFOS1_13k16.p1kpIBF_57 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 89 | 267 | 9851 | 8.08 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .8, HMM Prob: 1 | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1040aORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1040a OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1040b | LmxM.08.1040b.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1080 | LmxM.08.1040b | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_101:2,015..3,094(-) | 1036_mexFOS1_13k16.p1kpIBF_101:2015..3094(-) | 1036_mexFOS1_13k16.p1kpIBF_101 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 359 | 1080 | 38707 | 5.37 | 1 | HMM: MATSRAALCAVAVVCVVLAAACAPARAI, NN: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .8, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1040bORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1040b OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1040c | LmxM.08.1040c.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 996 | LmxM.08.1040c | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_31:3..998(-) | 1036_mexFOS1_13k16.p1kpIBF_31:3..998(-) | 1036_mexFOS1_13k16.p1kpIBF_31 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 332 | 996 | 35853 | 5.78 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .8, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1040cORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1040c OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1060 | LmxM.08.1060.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1101 | LmxM.08.1060 | cathepsin L-like protease, putative | cathepsin L-like protease, putative | | E9AMH5 | 8 | LmxM.08:1,582,805..1,583,905(-) | LmxM.08:1582805..1583905(-) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 366 | 1101 | 39493 | 5.55 | 1 | HMM: MATSRAALCAVAVVCVVLAAACAPARAI, NN: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .8, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1060ORcathepsin L-like protease, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1060 OR cathepsin L-like protease, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1070 | LmxM.08.1070.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1332 | LmxM.08.1070 | cathepsin L-like protease, putative | cathepsin L-like protease, putative | | E9AMH6 | 8 | LmxM.08:1,585,249..1,586,580(-) | LmxM.08:1585249..1586580(-) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 443 | 1332 | 47896 | 6.49 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .8, HMM Prob: 1 | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1070ORcathepsin L-like protease, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1070 OR cathepsin L-like protease, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1070partial | LmxM.08.1070partial.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1128 | LmxM.08.1070partial | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_96:1,267..2,394(-) | 1036_mexFOS1_13k16.p1kpIBF_96:1267..2394(-) | 1036_mexFOS1_13k16.p1kpIBF_96 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 375 | 1128 | 40462 | 6.17 | 0 | | | | | GO:0004197;GO:0008234 | cysteine-type endopeptidase activity;cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1070partialORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1070partial OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08.1080 | LmxM.08.1080.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1080 | LmxM.08.1080 | cathepsin L-like protease, putative | cathepsin L-like protease, putative | | E9AMH7 | 8 | LmxM.08:1,589,089..1,590,168(-) | LmxM.08:1589089..1590168(-) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 359 | 1080 | 38739 | 4.96 | 1 | NN: MATSRAALCAVAVVCVVLAAACAPARAI, HMM: MATSRAALCAVAVVCVVLAAACAPARAI | NN Sum: 4, NN D: .8, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08.1080ORcathepsin L-like protease, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08.1080 OR cathepsin L-like protease, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.0020 | LmxM.08_29.0020.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3138 | LmxM.08_29.0020 | transcription factor-like protein | transcription factor-like protein | | E9AM77 | 8 | LmxM.08:1,149,821..1,152,958(+) | LmxM.08:1149821..1152958(+) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_102309 | 0 | 1045 | 3138 | 114941 | 4.91 | 0 | NN: MQPSTNHTISVSRLSAVLAQWRAAAAR, HMM: MQPSTNHTISVSRLSAVLAQWRAAAAR | NN Sum: 2, NN D: .36, HMM Prob: .6 | | | | | | | GO:0005634 | nucleus | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.0020ORtranscription factor-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.0020 OR transcription factor-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.0820 | LmxM.08_29.0820.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1023 | LmxM.08_29.0820 | CPC cysteine peptidase, Clan CA, family C1, Cathepsin B-like | CPC cysteine peptidase, Clan CA, family C1, Cathepsin B-like | | E9ALZ5 | 8 | LmxM.08:848,597..849,619(+) | LmxM.08:848597..849619(+) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 79 | OG6_101151 | 0 | 340 | 1023 | 37178 | 5.67 | 1 | HMM: MAFRTKSALCLVAVFVVLLATTVSAL, NN: MAFRTKSALCLVAVFVVLLATTVSAL | NN Sum: 4, NN D: .9, HMM Prob: 1 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.1 (Cathepsin B) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.0820ORCPC cysteine peptidase, Clan CA, family C1, Cathepsin B-likeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.0820 OR CPC cysteine peptidase, Clan CA, family C1, Cathepsin B-like AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.0910 | LmxM.08_29.0910.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 930 | LmxM.08_29.0910 | signal peptide peptidase, putative | signal peptide peptidase, putative | | E9ALY2 | 8 | LmxM.08:809,030..809,959(-) | LmxM.08:809030..809959(-) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_102328 | 0 | 309 | 930 | 34086 | 4.78 | 8 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.0910ORsignal peptide peptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.0910 OR signal peptide peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.1270 | LmxM.08_29.1270.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2598 | LmxM.08_29.1270 | serine peptidase, putative | serine peptidase, putative | | E9ALU6 | 8 | LmxM.08:647,317..649,914(-) | LmxM.08:647317..649914(-) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 141 | OG6_100223 | 1 | 865 | 2598 | 96814 | 7.23 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.1270ORserine peptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.1270 OR serine peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.1570 | LmxM.08_29.1570.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1206 | LmxM.08_29.1570 | metallo-peptidase, Clan MH, Family M18 | metallo-peptidase, Clan MH, Family M18 | | E9ALR7 | 8 | LmxM.08:462,146..463,351(+) | LmxM.08:462146..463351(+) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 34 | OG6_152783 | 0 | 401 | 1206 | 43949 | 5.66 | 0 | | | GO:0005737 | cytoplasm | GO:0008777;GO:0016787 | acetylornithine deacetylase activity;hydrolase activity | GO:0006526;GO:0008152 | arginine biosynthetic process;metabolic process | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.1570ORmetallo-peptidase, Clan MH, Family M18ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.1570 OR metallo-peptidase, Clan MH, Family M18 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.2240 | LmxM.08_29.2240.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2607 | LmxM.08_29.2240 | Aminopeptidase M1, putative | Aminopeptidase M1, putative | | E9ALJ9 | 8 | LmxM.08:210,655..213,261(+) | LmxM.08:210655..213261(+) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 60 | OG6_137617 | 0 | 868 | 2607 | 96470 | 5.65 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.2240ORAminopeptidase M1, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.2240 OR Aminopeptidase M1, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.2300 | LmxM.08_29.2300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2247 | LmxM.08_29.2300 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9ALJ4 | 8 | LmxM.08:181,723..183,969(+) | LmxM.08:181723..183969(+) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_101380 | 0 | 748 | 2247 | 81499 | 5.47 | 0 | | | | | GO:0004843;GO:0036459;GO:0008270 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | GO:0005654 | nucleoplasm | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.2300ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.2300 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.2360 | LmxM.08_29.2360.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1362 | LmxM.08_29.2360 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | | E9ALI8 | 8 | LmxM.08:167,912..169,273(-) | LmxM.08:167912..169273(-) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_102047 | 0 | 453 | 1362 | 49627 | 6.50 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0031514 | cytoplasm;motile cilium | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.2360ORaspartyl aminopeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.2360 OR aspartyl aminopeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.08_29.2770 | LmxM.08_29.2770.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 615 | LmxM.08_29.2770 | hypothetical protein, conserved | hypothetical protein, conserved | | E9ALE7 | 8 | LmxM.08:27,621..28,235(-) | LmxM.08:27621..28235(-) | LmxM.08 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_158140 | 0 | 204 | 615 | 21985 | 6.79 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.08_29.2770ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.08_29.2770 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.09.0240 | LmxM.09.0240.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2850 | LmxM.09.0240 | cysteine peptidase, Clan CA, family C19, putative | cysteine peptidase, Clan CA, family C19, putative | | E9AMM3 | 9 | LmxM.09:81,559..84,408(+) | LmxM.09:81559..84408(+) | LmxM.09 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_103732 | 0 | 949 | 2850 | 105083 | 7.26 | 0 | HMM: MRLRLLPRCRRVTTSYLLPIMSATTASSR, NN: MRLRLLPRCRRVTTSYLLPIMSATTASSR | NN Sum: 2, NN D: .37, HMM Prob: .87 | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0005741 | cytoplasm;mitochondrial outer membrane | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.09.0240ORcysteine peptidase, Clan CA, family C19, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.09.0240 OR cysteine peptidase, Clan CA, family C19, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.09.0600 | LmxM.09.0600.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1008 | LmxM.09.0600 | cyclin 1 | cyclin 1 | | E9AMR1 | 9 | LmxM.09:223,238..224,245(+) | LmxM.09:223238..224245(+) | LmxM.09 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_127800 | 0 | 335 | 1008 | 35832 | 5.99 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.09.0600ORcyclin 1ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.09.0600 OR cyclin 1 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.09.0770 | LmxM.09.0770.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2196 | LmxM.09.0770 | oligopeptidase b | oligopeptidase b | | E9AMS8 | 9 | LmxM.09:294,087..296,282(-) | LmxM.09:294087..296282(-) | LmxM.09 | Leishmania mexicana MHOM/GT/2001/U1103 | 107 | OG6_102873 | 1 | 731 | 2196 | 83587 | 5.91 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0070012 | oligopeptidase activity | | | 3.4.21.83 (Oligopeptidase B) | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.09.0770ORoligopeptidase bANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.09.0770 OR oligopeptidase b AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.09.1300 | LmxM.09.1300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 657 | LmxM.09.1300 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9AMY1 | 9 | LmxM.09:478,355..479,011(-) | LmxM.09:478355..479011(-) | LmxM.09 | Leishmania mexicana MHOM/GT/2001/U1103 | 124 | OG6_101256 | 1 | 218 | 657 | 24309 | 6.23 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.09.1300ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.09.1300 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.09.1310 | LmxM.09.1310.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 765 | LmxM.09.1310 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9AMY2 | 9 | LmxM.09:480,808..481,572(-) | LmxM.09:480808..481572(-) | LmxM.09 | Leishmania mexicana MHOM/GT/2001/U1103 | 18 | OG6_199733 | 0 | 254 | 765 | 28312 | 6.85 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.09.1310ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.09.1310 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.10.0390 | LmxM.10.0390.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1809 | LmxM.10.0390 | GP63, leishmanolysin | GP63, leishmanolysin | | E9AN54 | 10 | LmxM.10:180,317..182,125(+) | LmxM.10:180317..182125(+) | LmxM.10 | Leishmania mexicana MHOM/GT/2001/U1103 | 617 | OG6_101754 | 6 | 602 | 1809 | 63792 | 7.69 | 1 | HMM: MSVDSSSTHRNRCVAARLVRLAAAGAAVTVAVGTAAAWAHAA, NN: MSVDSSSTHRNRCVAARLVRLAAAGAAVTVAVGTAAA | NN Sum: 2, NN D: .32, HMM Prob: .98 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.10.0390ORGP63, leishmanolysinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.10.0390 OR GP63, leishmanolysin AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.10.0405 | LmxM.10.0405.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1935 | LmxM.10.0405 | GP63, leishmanolysin | GP63, leishmanolysin | | E9AN55 | 10 | LmxM.10:182,927..184,861(+) | LmxM.10:182927..184861(+) | LmxM.10 | Leishmania mexicana MHOM/GT/2001/U1103 | 617 | OG6_101754 | 6 | 644 | 1935 | 68736 | 7.75 | 2 | HMM: MSVDSSSTHRNRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG, NN: MSVDSSSTHRNRCVAARLVRLAAAGAAVTVAVGTAAA | NN Sum: 2, NN D: .32, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.10.0405ORGP63, leishmanolysinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.10.0405 OR GP63, leishmanolysin AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.10.0460 | LmxM.10.0460.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1968 | LmxM.10.0460 | GP63, leishmanolysin | GP63, leishmanolysin | | E9AN53 | 10 | LmxM.10:175,230..177,197(+) | LmxM.10:175230..177197(+) | LmxM.10 | Leishmania mexicana MHOM/GT/2001/U1103 | 617 | OG6_101754 | 6 | 655 | 1968 | 69670 | 6.44 | 2 | HMM: MPVDSSSTHRHRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG, NN: MPVDSSSTHRHRCVAARLVRLAAAGAAVTVAVGTAAA | NN Sum: 2, NN D: .34, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.10.0460ORGP63, leishmanolysinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.10.0460 OR GP63, leishmanolysin AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.10.0465 | LmxM.10.0465.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1941 | LmxM.10.0465 | GP63, leishmanolysin | GP63, leishmanolysin | | E9AN56 | 10 | LmxM.10:186,440..188,380(+) | LmxM.10:186440..188380(+) | LmxM.10 | Leishmania mexicana MHOM/GT/2001/U1103 | 617 | OG6_101754 | 6 | 646 | 1941 | 69024 | 6.23 | 2 | NN: MPVDSSSTHRHRCVAARLVRLAAAGAAVTVAVGTAAA, HMM: MPVDSSSTHRHRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG | NN Sum: 2, NN D: .34, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.10.0465ORGP63, leishmanolysinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.10.0465 OR GP63, leishmanolysin AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.10.0465a | LmxM.10.0465a.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 756 | LmxM.10.0465a | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_56:1,678..2,433(-) | 1036_mexFOS1_13k16.p1kpIBF_56:1678..2433(-) | 1036_mexFOS1_13k16.p1kpIBF_56 | Leishmania mexicana MHOM/GT/2001/U1103 | 617 | OG6_101754 | 6 | 251 | 756 | 27281 | 6.24 | 0 | | | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.10.0465aORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.10.0465a OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.10.0470 | LmxM.10.0470.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1809 | LmxM.10.0470 | GP63, leishmanolysin | GP63, leishmanolysin | | E9AN57 | 10 | LmxM.10:190,957..192,765(+) | LmxM.10:190957..192765(+) | LmxM.10 | Leishmania mexicana MHOM/GT/2001/U1103 | 617 | OG6_101754 | 6 | 602 | 1809 | 63657 | 7.27 | 1 | NN: MPVDSSSTHRHRCVAARLVRLAAAGAAVTVAVGTAAA, HMM: MPVDSSSTHRHRCVAARLVRLAAAGAAVTVAVGTAAAWAHAG | NN Sum: 2, NN D: .34, HMM Prob: .96 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.10.0470ORGP63, leishmanolysinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.10.0470 OR GP63, leishmanolysin AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.11.0240 | LmxM.11.0240.1 | 1 | 1 | 1 | | | forward | protein coding | No | 744 | LmxM.11.0240 | proteasome alpha 7 subunit, putative | proteasome alpha 7 subunit, putative | | E9ANH0 | 11 | LmxM.11:64,342..65,085(+) | LmxM.11:64342..65085(+) | LmxM.11 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_101207 | 0 | 247 | 744 | 27779 | 5.74 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.11.0240ORproteasome alpha 7 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.11.0240 OR proteasome alpha 7 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.11.0620 | LmxM.11.0620.1 | 1 | 1 | 1 | | | forward | protein coding | No | 822 | LmxM.11.0620 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | E9ANK7 | 11 | LmxM.11:230,555..231,376(+) | LmxM.11:230555..231376(+) | LmxM.11 | Leishmania mexicana MHOM/GT/2001/U1103 | 67 | OG6_142599 | 1 | 273 | 822 | 29293 | 7.11 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.11.0620ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.11.0620 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.11.0630 | LmxM.11.0630.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1608 | LmxM.11.0630 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | E9ANK8 | 11 | LmxM.11:233,800..235,407(+) | LmxM.11:233800..235407(+) | LmxM.11 | Leishmania mexicana MHOM/GT/2001/U1103 | 67 | OG6_142599 | 1 | 535 | 1608 | 56931 | 6.75 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.11.0630ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.11.0630 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.11.0720 | LmxM.11.0720.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1962 | LmxM.11.0720 | PUF nine target 1 | PUF nine target 1 | | E9ANL7 | 11 | LmxM.11:273,923..275,884(+) | LmxM.11:273923..275884(+) | LmxM.11 | Leishmania mexicana MHOM/GT/2001/U1103 | 54 | OG6_146977 | 0 | 653 | 1962 | 70983 | 8.46 | 0 | HMM: MPPRRCPNRLLVLCASINDVTAW, NN: MPPRRCPNRLLVLCASINDVTAW | NN Sum: 3, NN D: .47, HMM Prob: .99 | | | | | | | GO:0020023 | kinetoplast | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.11.0720ORPUF nine target 1ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.11.0720 OR PUF nine target 1 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.12.0030 | LmxM.12.0030.1 | 1 | 1 | 1 | | | forward | protein coding | No | 852 | LmxM.12.0030 | proteasome beta-1 subunit, putative | proteasome beta-1 subunit, putative | | E9ANS8 | 12 | LmxM.12:5,586..6,437(+) | LmxM.12:5586..6437(+) | LmxM.12 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_101390 | 0 | 283 | 852 | 30501 | 7.26 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.12.0030ORproteasome beta-1 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.12.0030 OR proteasome beta-1 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.12.0190 | LmxM.12.0190.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4905 | LmxM.12.0190 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9ANU6 | 12 | LmxM.12:59,911..64,815(+) | LmxM.12:59911..64815(+) | LmxM.12 | Leishmania mexicana MHOM/GT/2001/U1103 | 26 | OG6_199649 | 0 | 1634 | 4905 | 172439 | 6.52 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.12.0190ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.12.0190 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.12.0210 | LmxM.12.0210.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1236 | LmxM.12.0210 | proteasome regulatory ATPase subunittcc1l8.3, putative | proteasome regulatory ATPase subunittcc1l8.3, putative | | E9ANU8 | 12 | LmxM.12:72,137..73,372(+) | LmxM.12:72137..73372(+) | LmxM.12 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_101965 | 0 | 411 | 1236 | 45866 | 8.55 | 0 | NN: MAASSVASVSATKASAMAA, HMM: MAASSVASVSATKASAM | NN Sum: 0, NN D: .08, HMM Prob: .54 | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005838 | proteasome regulatory particle | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.12.0210ORproteasome regulatory ATPase subunittcc1l8.3, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.12.0210 OR proteasome regulatory ATPase subunittcc1l8.3, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.12.0240 | LmxM.12.0240.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2103 | LmxM.12.0240 | hypothetical protein, unknown function | hypothetical protein, unknown function | | E9ANV1 | 12 | LmxM.12:81,451..83,553(+) | LmxM.12:81451..83553(+) | LmxM.12 | Leishmania mexicana MHOM/GT/2001/U1103 | 44 | OG6_139763 | 0 | 700 | 2103 | 74137 | 7.10 | 1 | HMM: MVFTGHCAADVAPMCLVDRMKQRCRGRLPSLLMCAVLFAQLLLCSTSLPVAADAT, NN: MVFTGHCAADVAPMCLVDRMKQRCRGRLPSLLMCAVLFAQLLLCSTSLPVAAD | NN Sum: 2, NN D: .35, HMM Prob: .76 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.12.0240ORhypothetical protein, unknown functionANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.12.0240 OR hypothetical protein, unknown function AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.12.1250 | LmxM.12.1250.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4149 | LmxM.12.1250 | puromycin-sensitive aminopeptidase-like protein | puromycin-sensitive aminopeptidase-like protein | | E9AP25 | 12 | LmxM.12:469,081..473,229(+) | LmxM.12:469081..473229(+) | LmxM.12 | Leishmania mexicana MHOM/GT/2001/U1103 | 46 | OG6_156775 | 0 | 1382 | 4149 | 150484 | 6.65 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.12.1250ORpuromycin-sensitive aminopeptidase-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.12.1250 OR puromycin-sensitive aminopeptidase-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.12.1330 | LmxM.12.1330.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1863 | LmxM.12.1330 | Alpha/beta hydrolase domain-containing protein | Alpha/beta hydrolase domain-containing protein | | E9AP33 | 12 | LmxM.12:495,098..496,960(+) | LmxM.12:495098..496960(+) | LmxM.12 | Leishmania mexicana MHOM/GT/2001/U1103 | 86 | OG6_100915 | 1 | 620 | 1863 | 69273 | 6.85 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.12.1330ORAlpha/beta hydrolase domain-containing proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.12.1330 OR Alpha/beta hydrolase domain-containing protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.13.0090 | LmxM.13.0090.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1512 | LmxM.13.0090 | metallo-peptidase, Clan MA(E) Family M32 | metallo-peptidase, Clan MA(E) Family M32 | | E9AP43 | 13 | LmxM.13:23,895..25,406(-) | LmxM.13:23895..25406(-) | LmxM.13 | Leishmania mexicana MHOM/GT/2001/U1103 | 154 | OG6_105939 | 1 | 503 | 1512 | 57250 | 5.89 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.13.0090ORmetallo-peptidase, Clan MA(E) Family M32ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.13.0090 OR metallo-peptidase, Clan MA(E) Family M32 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.13.0680 | LmxM.13.0680.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1698 | LmxM.13.0680 | Metallopeptidase family M24, putative | Metallopeptidase family M24, putative | | E9AP92 | 13 | LmxM.13:195,238..196,935(+) | LmxM.13:195238..196935(+) | LmxM.13 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_146697 | 0 | 565 | 1698 | 60596 | 9.66 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.13.0680ORMetallopeptidase family M24, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.13.0680 OR Metallopeptidase family M24, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.13.0870 | LmxM.13.0870.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1587 | LmxM.13.0870 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | | E9APB1 | 13 | LmxM.13:272,274..273,860(-) | LmxM.13:272274..273860(-) | LmxM.13 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_146937 | 0 | 528 | 1587 | 57637 | 7.85 | 0 | HMM: MFRRVVAPAPVAATAACAGQVRSI, NN: MFRRVVAPAPVAATAACAGQVRSI | NN Sum: 1, NN D: .35, HMM Prob: .97 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005739 | mitochondrion | | | | | 3.4.99.41 (Transferred entry: 3.4.24.64) | 3.4.99.41 (Transferred entry: 3.4.24.64) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.13.0870ORmitochondrial processing peptidase alpha subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.13.0870 OR mitochondrial processing peptidase alpha subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.13.1040 | LmxM.13.1040.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5286 | LmxM.13.1040 | subtilisin peptidase | subtilisin peptidase | | E9APC8 | 13 | LmxM.13:326,740..332,025(-) | LmxM.13:326740..332025(-) | LmxM.13 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_136864 | 0 | 1761 | 5286 | 186341 | 7.81 | 2 | NN: MEAVVALRLLTIHILAALLLVLPSFPVAE, HMM: MEAVVALRLLTIHILAALLLVLPSFPVAE | NN Sum: 3, NN D: .67, HMM Prob: .93 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | GO:0004252 | serine-type endopeptidase activity | GO:0030154;GO:0045454;GO:0009405 | cell differentiation;cell redox homeostasis;pathogenesis | | 3.4.21.112 (Site-1 protease) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.13.1040ORsubtilisin peptidaseANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.13.1040 OR subtilisin peptidase AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.13.1090 | LmxM.13.1090.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1317 | LmxM.13.1090 | proteasome regulatory ATPase subunit 2, putative | proteasome regulatory ATPase subunit 2, putative | | E9APD3 | 13 | LmxM.13:354,676..355,992(-) | LmxM.13:354676..355992(-) | LmxM.13 | Leishmania mexicana MHOM/GT/2001/U1103 | 54 | OG6_101477 | 0 | 438 | 1317 | 49262 | 5.60 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | | | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.13.1090ORproteasome regulatory ATPase subunit 2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.13.1090 OR proteasome regulatory ATPase subunit 2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.13.1140 | LmxM.13.1140.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1212 | LmxM.13.1140 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | E9APD8 | 13 | LmxM.13:369,327..370,538(-) | LmxM.13:369327..370538(-) | LmxM.13 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_101420 | 0 | 403 | 1212 | 43790 | 7.94 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.13.1140ORAlpha/beta hydrolase family, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.13.1140 OR Alpha/beta hydrolase family, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.14.0180 | LmxM.14.0180.1 | 1 | 1 | 1 | | | forward | protein coding | Yes | 1431 | LmxM.14.0180 | metallo-peptidase, Clan MA(E), Family M32 | metallo-peptidase, Clan MA(E), Family M32 | | | 14 | LmxM.14:46,143..47,573(+) | LmxM.14:46143..47573(+) | LmxM.14 | Leishmania mexicana MHOM/GT/2001/U1103 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 476 | 1431 | 53733 | 5.92 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.17.19 (Carboxypeptidase Taq) | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.14.0180ORmetallo-peptidase, Clan MA(E), Family M32ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.14.0180 OR metallo-peptidase, Clan MA(E), Family M32 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.14.0310 | LmxM.14.0310.1 | 1 | 1 | 1 | | | forward | protein coding | No | 858 | LmxM.14.0310 | proteasome alpha 3 subunit, putative | proteasome alpha 3 subunit, putative | | E9APM4 | 14 | LmxM.14:82,672..83,529(+) | LmxM.14:82672..83529(+) | LmxM.14 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_101968 | 0 | 285 | 858 | 32232 | 5.22 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.14.0310ORproteasome alpha 3 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.14.0310 OR proteasome alpha 3 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.15.0090 | LmxM.15.0090.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1272 | LmxM.15.0090 | ATP-dependent protease ATPase subunit HslU1, putative | ATP-dependent protease ATPase subunit HslU1, putative | | E9AQ06 | 15 | LmxM.15:27,693..28,964(-) | LmxM.15:27693..28964(-) | LmxM.15 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_106348 | 0 | 423 | 1272 | 47550 | 6.54 | 0 | | | GO:0009376;GO:0005737 | HslUV protease complex;cytoplasm | GO:0005524;GO:0016887;GO:0070011 | ATP binding;ATPase activity;peptidase activity, acting on L-amino acid peptides | | | GO:0009376;GO:0005737;GO:0042645 | HslUV protease complex;cytoplasm;mitochondrial nucleoid | | | GO:0006264;GO:0070581 | mitochondrial DNA replication;rolling circle DNA replication | | 2.7.1.71 (Shikimate kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.15.0090ORATP-dependent protease ATPase subunit HslU1, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.15.0090 OR ATP-dependent protease ATPase subunit HslU1, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.15.0580 | LmxM.15.0580.1 | 1 | 1 | 1 | | | forward | protein coding | No | 978 | LmxM.15.0580 | signal peptidase subunit, putative | signal peptidase subunit, putative | | E9AQ55 | 15 | LmxM.15:210,193..211,170(+) | LmxM.15:210193..211170(+) | LmxM.15 | Leishmania mexicana MHOM/GT/2001/U1103 | 27 | OG6_165119 | 0 | 325 | 978 | 36347 | 9.65 | 1 | HMM: MHSMRQRSCDIVASTVSALLVTAVLTA, NN: MHSMRQRSCDIVASTVSALLVTAVLTA | NN Sum: 2, NN D: .47, HMM Prob: .71 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.15.0580ORsignal peptidase subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.15.0580 OR signal peptidase subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.15.1300 | LmxM.15.1300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4251 | LmxM.15.1300 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9AQC2 | 15 | LmxM.15:479,298..483,548(-) | LmxM.15:479298..483548(-) | LmxM.15 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_145141 | 0 | 1416 | 4251 | 155041 | 5.45 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.15.1300ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.15.1300 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.15.1530 | LmxM.15.1530.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1059 | LmxM.15.1530 | presenilin-like aspartic peptidase, putative | presenilin-like aspartic peptidase, putative | | E9AQF0 | 15 | LmxM.15:555,988..557,046(-) | LmxM.15:555988..557046(-) | LmxM.15 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_101989 | 0 | 352 | 1059 | 38884 | 7.46 | 7 | | | GO:0016021 | integral component of membrane | GO:0004190 | aspartic-type endopeptidase activity | GO:0016485 | protein processing | GO:0005737 | cytoplasm | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.15.1530ORpresenilin-like aspartic peptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.15.1530 OR presenilin-like aspartic peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.16.0290 | LmxM.16.0290.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 762 | LmxM.16.0290 | proteasome 26S non-ATPase subunit 9, putative | proteasome 26S non-ATPase subunit 9, putative | | E9AQI6 | 16 | LmxM.16:102,883..103,644(-) | LmxM.16:102883..103644(-) | LmxM.16 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_102356 | 0 | 253 | 762 | 27941 | 4.64 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.16.0290ORproteasome 26S non-ATPase subunit 9, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.16.0290 OR proteasome 26S non-ATPase subunit 9, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.16.0730 | LmxM.16.0730.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 5694 | LmxM.16.0730 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9AQN2 | 16 | LmxM.16:248,029..253,722(-) | LmxM.16:248029..253722(-) | LmxM.16 | Leishmania mexicana MHOM/GT/2001/U1103 | 54 | OG6_154037 | 0 | 1897 | 5694 | 200231 | 6.25 | 0 | HMM: MSACVTGTASAALLGVGDLWAS, NN: MSACVTGTASAALLGVGDLWAS | NN Sum: 1, NN D: .38, HMM Prob: .97 | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.16.0730ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.16.0730 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.16.1385 | LmxM.16.1385.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2844 | LmxM.16.1385 | hypothetical protein, conserved | hypothetical protein, conserved | | E9AQV0 | 16 | LmxM.16:555,625..558,468(-) | LmxM.16:555625..558468(-) | LmxM.16 | Leishmania mexicana MHOM/GT/2001/U1103 | 30 | OG6_110278 | 0 | 947 | 2844 | 101125 | 8.91 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.16.1385ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.16.1385 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.16.1550 | LmxM.16.1550.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3708 | LmxM.16.1550 | Component of motile flagella 6, putative | Component of motile flagella 6, putative | | E9AQW8 | 16 | LmxM.16:633,490..637,197(+) | LmxM.16:633490..637197(+) | LmxM.16 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_102663 | 0 | 1235 | 3708 | 139082 | 6.32 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005930;GO:0005737 | axoneme;cytoplasm | | | GO:0060285 | cilium-dependent cell motility | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.16.1550ORComponent of motile flagella 6, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.16.1550 OR Component of motile flagella 6, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.17.0140 | LmxM.17.0140.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1272 | LmxM.17.0140 | peptidase t, putative | peptidase t, putative | | E9AQY9 | 17 | LmxM.17:101,037..102,308(-) | LmxM.17:101037..102308(-) | LmxM.17 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_111055 | 0 | 423 | 1272 | 46688 | 6.19 | 0 | | | GO:0005737 | cytoplasm | GO:0016787;GO:0045148;GO:0008270 | hydrolase activity;tripeptide aminopeptidase activity;zinc ion binding | GO:0008152;GO:0006518 | metabolic process;peptide metabolic process | | | | | | | 3.4.11.14 (Cytosol alanyl aminopeptidase) | 3.4.11.4 (Tripeptide aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.17.0140ORpeptidase t, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.17.0140 OR peptidase t, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.17.1090 | LmxM.17.1090.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3942 | LmxM.17.1090 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | E9AR81 | 17 | LmxM.17:514,876..518,817(+) | LmxM.17:514876..518817(+) | LmxM.17 | Leishmania mexicana MHOM/GT/2001/U1103 | 25 | OG6_199796 | 0 | 1313 | 3942 | 140702 | 6.44 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.17.1090ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.17.1090 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.17.1110 | LmxM.17.1110.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4293 | LmxM.17.1110 | kinesin, putative | kinesin, putative | | E9AR83 | 17 | LmxM.17:522,097..526,389(+) | LmxM.17:522097..526389(+) | LmxM.17 | Leishmania mexicana MHOM/GT/2001/U1103 | 54 | OG6_146515 | 0 | 1430 | 4293 | 158160 | 6.98 | 0 | | | | | GO:0005524;GO:0005488;GO:0008017;GO:0003777;GO:0005515 | ATP binding;binding;microtubule binding;microtubule motor activity;protein binding | GO:0007018 | microtubule-based movement | GO:0005930;GO:0097542 | axoneme;ciliary tip | | | GO:0010608 | posttranscriptional regulation of gene expression | | 3.6.4.4 (Transferred entry: 5.6.1.3) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.17.1110ORkinesin, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.17.1110 OR kinesin, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.17.1290 | LmxM.17.1290.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2130 | LmxM.17.1290 | eukaryotic translation initiation factor 3 subunit b | eukaryotic translation initiation factor 3 subunit b | | E9ARA1 | 17 | LmxM.17:595,738..597,867(+) | LmxM.17:595738..597867(+) | LmxM.17 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_101924 | 0 | 709 | 2130 | 80717 | 7.52 | 0 | | | | | | | | | GO:0005737;GO:0005852 | cytoplasm;eukaryotic translation initiation factor 3 complex | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.17.1290OReukaryotic translation initiation factor 3 subunit bANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.17.1290 OR eukaryotic translation initiation factor 3 subunit b AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.17.1400 | LmxM.17.1400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 813 | LmxM.17.1400 | otubain cysteine peptidase, Clan CA, family C65, putative | otubain cysteine peptidase, Clan CA, family C65, putative | | E9ARB4 | 17 | LmxM.17:633,339..634,151(+) | LmxM.17:633339..634151(+) | LmxM.17 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_102549 | 0 | 270 | 813 | 30465 | 4.40 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.17.1400ORotubain cysteine peptidase, Clan CA, family C65, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.17.1400 OR otubain cysteine peptidase, Clan CA, family C65, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.18.0360 | LmxM.18.0360.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1029 | LmxM.18.0360 | cysteine peptidase, Clan CD, family C13, putative | cysteine peptidase, Clan CD, family C13, putative | | E9ARH3 | 18 | LmxM.18:144,136..145,164(-) | LmxM.18:144136..145164(-) | LmxM.18 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_101767 | 0 | 342 | 1029 | 38093 | 5.87 | 1 | HMM: MTSPTRCIATALIVFAFLVLTAAAAASA, NN: MTSPTRCIATALIVFAFLVLTAAAAA | NN Sum: 4, NN D: .76, HMM Prob: 1 | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | GO:0005783;GO:0005635 | endoplasmic reticulum;nuclear envelope | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.18.0360ORcysteine peptidase, Clan CD, family C13, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.18.0360 OR cysteine peptidase, Clan CD, family C13, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.18.0450 | LmxM.18.0450.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1389 | LmxM.18.0450 | serine peptidase, Clan SC, Family S10 | serine peptidase, Clan SC, Family S10 | | E9ARI2 | 18 | LmxM.18:178,691..180,079(-) | LmxM.18:178691..180079(-) | LmxM.18 | Leishmania mexicana MHOM/GT/2001/U1103 | 158 | OG6_100109 | 0 | 462 | 1389 | 51728 | 4.75 | 1 | NN: MASSLSTTALLVALLVAMVPLACVPTVHAS, HMM: MASSLSTTALLVALLVAMVPLACVPTVHAS | NN Sum: 4, NN D: .89, HMM Prob: 1 | | | GO:0004185 | serine-type carboxypeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.16.5 (Carboxypeptidase C) | 3.4.16.- (Serine-type carboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.18.0450ORserine peptidase, Clan SC, Family S10ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.18.0450 OR serine peptidase, Clan SC, Family S10 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.18.0610 | LmxM.18.0610.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1797 | LmxM.18.0610 | metallo-peptidase, Clan MA(E), Family M41 | metallo-peptidase, Clan MA(E), Family M41 | | E9ARJ9 | 18 | LmxM.18:244,019..245,815(+) | LmxM.18:244019..245815(+) | LmxM.18 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_139899 | 0 | 598 | 1797 | 64944 | 6.53 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.18.0610ORmetallo-peptidase, Clan MA(E), Family M41ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.18.0610 OR metallo-peptidase, Clan MA(E), Family M41 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.18.1060 | LmxM.18.1060.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2292 | LmxM.18.1060 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9ARP3 | 18 | LmxM.18:435,940..438,231(+) | LmxM.18:435940..438231(+) | LmxM.18 | Leishmania mexicana MHOM/GT/2001/U1103 | 39 | OG6_158065 | 0 | 763 | 2292 | 84752 | 6.58 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.18.1060ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.18.1060 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.18.1320 | LmxM.18.1320.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4413 | LmxM.18.1320 | hypothetical protein, conserved | hypothetical protein, conserved | | E9ARR6 | 18 | LmxM.18:525,009..529,421(+) | LmxM.18:525009..529421(+) | LmxM.18 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_156926 | 0 | 1470 | 4413 | 160605 | 6.58 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.18.1320ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.18.1320 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.19.0130 | LmxM.19.0130.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 762 | LmxM.19.0130 | Der1-like family, putative | Der1-like family, putative | | E9ARW4 | 19 | LmxM.19:23,453..24,214(-) | LmxM.19:23453..24214(-) | LmxM.19 | Leishmania mexicana MHOM/GT/2001/U1103 | 95 | OG6_101672 | 1 | 253 | 762 | 28354 | 9.17 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.19.0130ORDer1-like family, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.19.0130 OR Der1-like family, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.19.0160 | LmxM.19.0160.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1143 | LmxM.19.0160 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | E9ARW7 | 19 | LmxM.19:32,659..33,801(-) | LmxM.19:32659..33801(-) | LmxM.19 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_101895 | 0 | 380 | 1143 | 42470 | 5.67 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.19.0160ORmetallo-peptidase, Clan MG, Family M24ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.19.0160 OR metallo-peptidase, Clan MG, Family M24 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.19.0550 | LmxM.19.0550.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1206 | LmxM.19.0550 | metallo- peptidase, Clan MG, Family M24 | metallo- peptidase, Clan MG, Family M24 | | E9AS06 | 19 | LmxM.19:207,970..209,175(+) | LmxM.19:207970..209175(+) | LmxM.19 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_100342 | 0 | 401 | 1206 | 44914 | 6.12 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.19.0550ORmetallo- peptidase, Clan MG, Family M24ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.19.0550 OR metallo- peptidase, Clan MG, Family M24 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.19.1420 | LmxM.19.1420.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1065 | LmxM.19.1420 | cysteine peptidase A (CPA) | cysteine peptidase A (CPA) | | E9AS96 | 19 | LmxM.19:585,383..586,447(+) | LmxM.19:585383..586447(+) | LmxM.19 | Leishmania mexicana MHOM/GT/2001/U1103 | 536 | OG6_100116 | 12 | 354 | 1065 | 38745 | 6.67 | 1 | HMM: MARRNPLLFAIVVTILFVVCYGSAL, NN: MARRNPLLFAIVVTILFVVCYGSAL | NN Sum: 4, NN D: .83, HMM Prob: .72 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.19.1420ORcysteine peptidase A (CPA)ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.19.1420 OR cysteine peptidase A (CPA) AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.19.1590 | LmxM.19.1590.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1797 | LmxM.19.1590 | ATP-dependent zinc metallopeptidase | ATP-dependent zinc metallopeptidase | | E9ASB2 | 19 | LmxM.19:634,301..636,097(+) | LmxM.19:634301..636097(+) | LmxM.19 | Leishmania mexicana MHOM/GT/2001/U1103 | 67 | OG6_139691 | 0 | 598 | 1797 | 64576 | 7.95 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.19.1590ORATP-dependent zinc metallopeptidaseANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.19.1590 OR ATP-dependent zinc metallopeptidase AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.19.1630 | LmxM.19.1630.1 | 1 | 1 | 1 | | | forward | protein coding | No | 378 | LmxM.19.1630 | ATG8/AUT7/APG8/PAZ2, putative | ATG8/AUT7/APG8/PAZ2, putative | | E9ASB6 | 19 | LmxM.19:641,056..641,433(+) | LmxM.19:641056..641433(+) | LmxM.19 | Leishmania mexicana MHOM/GT/2001/U1103 | 66 | OG6_100707 | 0 | 125 | 378 | 14100 | 8.45 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.19.1630ORATG8/AUT7/APG8/PAZ2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.19.1630 OR ATG8/AUT7/APG8/PAZ2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1180 | LmxM.20.1180.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2805 | LmxM.20.1180 | calpain-like cysteine peptidase | calpain-like cysteine peptidase | | E9AUQ7 | 20 | LmxM.20:3,139,805..3,142,609(+) | LmxM.20:3139805..3142609(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 136 | OG6_127587 | 2 | 934 | 2805 | 103528 | 4.12 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1180ORcalpain-like cysteine peptidaseANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1180 OR calpain-like cysteine peptidase AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1185 | LmxM.20.1185.1 | 2 | 2 | 1 | | | forward | protein coding | No | 1956 | LmxM.20.1185 | calpain-like cysteine peptidase, putative | calpain-like cysteine peptidase, putative | | E9AUQ8 | 20 | LmxM.20:3,145,378..3,147,435(+) | LmxM.20:3145378..3147435(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 136 | OG6_127587 | 2 | 651 | 1956 | 73190 | 4.54 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1185ORcalpain-like cysteine peptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1185 OR calpain-like cysteine peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1190 | LmxM.20.1190.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2064 | LmxM.20.1190 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9AUQ9 | 20 | LmxM.20:3,150,116..3,152,179(+) | LmxM.20:3150116..3152179(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_155901 | 0 | 687 | 2064 | 78263 | 4.80 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930;GO:0005737 | axoneme;cytoplasm | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1190ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1190 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1200 | LmxM.20.1200.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2232 | LmxM.20.1200 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9AUR0 | 20 | LmxM.20:3,156,577..3,158,808(+) | LmxM.20:3156577..3158808(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 28 | OG6_199937 | 0 | 743 | 2232 | 83273 | 6.57 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1200ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1200 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1210 | LmxM.20.1210.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1650 | LmxM.20.1210 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9AUR1 | 20 | LmxM.20:3,163,612..3,165,261(+) | LmxM.20:3163612..3165261(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 36 | OG6_199938 | 0 | 549 | 1650 | 60270 | 7.56 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1210ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1210 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1240 | LmxM.20.1240.1 | 1 | 1 | 1 | | | forward | protein coding | No | 8256 | LmxM.20.1240 | Raptor N-terminal CASPase like domain containing protein, putative | Raptor N-terminal CASPase like domain containing protein, putative | | E9AUR4 | 20 | LmxM.20:3,173,330..3,181,585(+) | LmxM.20:3173330..3181585(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_147359 | 0 | 2751 | 8256 | 293939 | 6.93 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1240ORRaptor N-terminal CASPase like domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1240 OR Raptor N-terminal CASPase like domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1550 | LmxM.20.1550.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1206 | LmxM.20.1550 | amidohydrolase, putative | amidohydrolase, putative | | E9AUV6 | 20 | LmxM.20:3,318,575..3,319,780(-) | LmxM.20:3318575..3319780(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 181 | OG6_101553 | 4 | 401 | 1206 | 43528 | 6.05 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1550ORamidohydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1550 OR amidohydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1560 | LmxM.20.1560.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1191 | LmxM.20.1560 | amidohydrolase, putative | amidohydrolase, putative | | E9AUV7 | 20 | LmxM.20:3,320,833..3,322,023(-) | LmxM.20:3320833..3322023(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 181 | OG6_101553 | 4 | 396 | 1191 | 42963 | 5.58 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1560ORamidohydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1560 OR amidohydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.20.1570 | LmxM.20.1570.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | LmxM.20.1570 | amidohydrolase, putative | amidohydrolase, putative | | E9AUV8 | 20 | LmxM.20:3,323,751..3,324,932(-) | LmxM.20:3323751..3324932(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 181 | OG6_101553 | 4 | 393 | 1182 | 42796 | 5.15 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0097014;GO:0005737;GO:0005654 | ciliary plasm;cytoplasm;nucleoplasm | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.20.1570ORamidohydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.20.1570 OR amidohydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.21.0120 | LmxM.21.0120.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4881 | LmxM.21.0120 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9AUX8 | 21 | LmxM.21:25,977..30,857(+) | LmxM.21:25977..30857(+) | LmxM.21 | Leishmania mexicana MHOM/GT/2001/U1103 | 54 | OG6_148289 | 0 | 1626 | 4881 | 180387 | 6.56 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.21.0120ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.21.0120 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.21.0340 | LmxM.21.0340.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1404 | LmxM.21.0340 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | | E9AV01 | 21 | LmxM.21:104,068..105,471(+) | LmxM.21:104068..105471(+) | LmxM.21 | Leishmania mexicana MHOM/GT/2001/U1103 | 44 | OG6_155541 | 0 | 467 | 1404 | 51458 | 7.68 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.21.0340ORmitochondrial processing peptidase alpha subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.21.0340 OR mitochondrial processing peptidase alpha subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.21.0400 | LmxM.21.0400.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1941 | LmxM.21.0400 | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative | | E9AV07 | 21 | LmxM.21:117,581..119,521(+) | LmxM.21:117581..119521(+) | LmxM.21 | Leishmania mexicana MHOM/GT/2001/U1103 | 27 | OG6_101733 | 0 | 646 | 1941 | 71318 | 8.25 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | GO:0004197;GO:0004221 | cysteine-type endopeptidase activity;obsolete ubiquitin thiolesterase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.21.0400ORPeptidase C19, ubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.21.0400 OR Peptidase C19, ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.21.0840 | LmxM.21.0840.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1398 | LmxM.21.0840 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | E9AV56 | 21 | LmxM.21:293,732..295,129(+) | LmxM.21:293732..295129(+) | LmxM.21 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_100815 | 0 | 465 | 1398 | 51259 | 6.84 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0008237 | metallopeptidase activity | GO:0006508 | proteolysis | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.21.0840ORmetallo-peptidase, Clan MG, Family M24ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.21.0840 OR metallo-peptidase, Clan MG, Family M24 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.21.1700 | LmxM.21.1700.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 696 | LmxM.21.1700 | proteasome alpha 2 subunit, putative | proteasome alpha 2 subunit, putative | | E9AVG6 | 21 | LmxM.21:696,031..696,726(-) | LmxM.21:696031..696726(-) | LmxM.21 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_101969 | 0 | 231 | 696 | 25088 | 5.74 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737 | cytoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.21.1700ORproteasome alpha 2 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.21.1700 OR proteasome alpha 2 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.21.1830 | LmxM.21.1830.1 | 1 | 1 | 1 | | | forward | protein coding | No | 735 | LmxM.21.1830 | proteasome subunit alpha type-5, putative | proteasome subunit alpha type-5, putative | | E9AVH9 | 21 | LmxM.21:718,657..719,391(+) | LmxM.21:718657..719391(+) | LmxM.21 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_101621 | 0 | 244 | 735 | 26857 | 5.03 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005829;GO:0005634;GO:0005839 | cytosol;nucleus;proteasome core complex | | | GO:0006511 | ubiquitin-dependent protein catabolic process | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.21.1830ORproteasome subunit alpha type-5, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.21.1830 OR proteasome subunit alpha type-5, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.22.0570 | LmxM.22.0570.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1314 | LmxM.22.0570 | proteasome regulatory ATPase subunit 1, putative | proteasome regulatory ATPase subunit 1, putative | | E9AVN9 | 22 | LmxM.22:212,669..213,982(-) | LmxM.22:212669..213982(-) | LmxM.22 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_101899 | 0 | 437 | 1314 | 49005 | 6.43 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.22.0570ORproteasome regulatory ATPase subunit 1, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.22.0570 OR proteasome regulatory ATPase subunit 1, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.22.0620 | LmxM.22.0620.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1335 | LmxM.22.0620 | proteasome regulatory ATPase subunit 5, putative | proteasome regulatory ATPase subunit 5, putative | | E9AVP4 | 22 | LmxM.22:226,998..228,332(-) | LmxM.22:226998..228332(-) | LmxM.22 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_101915 | 0 | 444 | 1335 | 49468 | 5.64 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.22.0620ORproteasome regulatory ATPase subunit 5, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.22.0620 OR proteasome regulatory ATPase subunit 5, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.23.0460 | LmxM.23.0460.1 | 1 | 1 | 1 | | | forward | protein coding | No | 900 | LmxM.23.0460 | trypanothione synthetase, putative | trypanothione synthetase, putative | | E9AW49 | 23 | LmxM.23:168,480..169,379(+) | LmxM.23:168480..169379(+) | LmxM.23 | Leishmania mexicana MHOM/GT/2001/U1103 | 24 | OG6_173685 | 0 | 299 | 900 | 33079 | 9.00 | 0 | | | | | | | | | | | | | | | 6.3.1.9 (Trypanothione synthase) | 6.3.1.9 (Trypanothione synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.23.0460ORtrypanothione synthetase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.23.0460 OR trypanothione synthetase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.23.0950 | LmxM.23.0950.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1698 | LmxM.23.0950 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | E9AWA7 | 23 | LmxM.23:442,747..444,444(-) | LmxM.23:442747..444444(-) | LmxM.23 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_100682 | 0 | 565 | 1698 | 60247 | 9.52 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0030863 | cortical cytoskeleton | | | | | 3.4.11.1 (Leucyl aminopeptidase) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.23.0950ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.23.0950 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.24.0420 | LmxM.24.0420.1 | 1 | 1 | 1 | | | forward | protein coding | No | 924 | LmxM.24.0420 | ubiquitin carboxyl-terminal hydrolase, putative,cysteine peptidase, Clan CA, family C12, putative | ubiquitin carboxyl-terminal hydrolase, putative,cysteine peptidase, Clan CA, family C12, putative | | E9AWN2 | 24 | LmxM.24:138,776..139,699(+) | LmxM.24:138776..139699(+) | LmxM.24 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_102753 | 0 | 307 | 924 | 34440 | 4.93 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579;GO:0006511 | protein deubiquitination;ubiquitin-dependent protein catabolic process | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.24.0420ORubiquitin carboxyl-terminal hydrolase, putative,cysteine peptidase, Clan CA, family C12, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.24.0420 OR ubiquitin carboxyl-terminal hydrolase, putative,cysteine peptidase, Clan CA, family C12, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.24.0620 | LmxM.24.0620.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2424 | LmxM.24.0620 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9AWQ2 | 24 | LmxM.24:218,147..220,570(+) | LmxM.24:218147..220570(+) | LmxM.24 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_101457 | 0 | 807 | 2424 | 89206 | 9.88 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005634 | nucleus | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.24.0620ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.24.0620 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.24.0650 | LmxM.24.0650.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2907 | LmxM.24.0650 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9AWQ5 | 24 | LmxM.24:228,361..231,267(+) | LmxM.24:228361..231267(+) | LmxM.24 | Leishmania mexicana MHOM/GT/2001/U1103 | 124 | OG6_101256 | 1 | 968 | 2907 | 102329 | 6.64 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.24.0650ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.24.0650 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.25.0190 | LmxM.25.0190.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 702 | LmxM.25.0190 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9AX95 | 25 | LmxM.25:56,878..57,579(-) | LmxM.25:56878..57579(-) | LmxM.25 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_101218 | 0 | 233 | 702 | 25249 | 5.78 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.25.0190ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.25.0190 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.25.1480 | LmxM.25.1480.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2118 | LmxM.25.1480 | calpain family cysteine protease-like protein | calpain family cysteine protease-like protein | | E9AXM9 | 25 | LmxM.25:579,466..581,583(-) | LmxM.25:579466..581583(-) | LmxM.25 | Leishmania mexicana MHOM/GT/2001/U1103 | 29 | OG6_163536 | 0 | 705 | 2118 | 80020 | 9.70 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.25.1480ORcalpain family cysteine protease-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.25.1480 OR calpain family cysteine protease-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.25.1790 | LmxM.25.1790.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 903 | LmxM.25.1790 | hypothetical protein, conserved | hypothetical protein, conserved | | E9AXR1 | 25 | LmxM.25:692,808..693,710(-) | LmxM.25:692808..693710(-) | LmxM.25 | Leishmania mexicana MHOM/GT/2001/U1103 | 98 | OG6_158192 | 0 | 300 | 903 | 34611 | 5.98 | 1 | HMM: MNLLRVALLCACTTLLCLGA, NN: MNLLRVALLCACTTLLCLGA | NN Sum: 4, NN D: .75, HMM Prob: .92 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.25.1790ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.25.1790 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.25.2320 | LmxM.25.2320.1 | 1 | 1 | 1 | | | forward | protein coding | No | 438 | LmxM.25.2320 | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | Microsomal signal peptidase 12 kDa subunit (SPC12), putative | | E9AXW6 | 25 | LmxM.25:840,949..841,386(+) | LmxM.25:840949..841386(+) | LmxM.25 | Leishmania mexicana MHOM/GT/2001/U1103 | 43 | OG6_147500 | 0 | 145 | 438 | 15753 | 8.20 | 1 | | | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | GO:0005783 | endoplasmic reticulum | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.25.2320ORMicrosomal signal peptidase 12 kDa subunit (SPC12), putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.25.2320 OR Microsomal signal peptidase 12 kDa subunit (SPC12), putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.25.2380 | LmxM.25.2380.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2160 | LmxM.25.2380 | glutathionylspermidine synthase, putative | glutathionylspermidine synthase, putative | | E9AXX3 | 25 | LmxM.25:861,986..864,145(+) | LmxM.25:861986..864145(+) | LmxM.25 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_200119 | 0 | 719 | 2160 | 80504 | 5.62 | 0 | | | | | | | | | | | | | | | 6.3.1.8 (Glutathionylspermidine synthase) | 6.3.1.8 (Glutathionylspermidine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.25.2380ORglutathionylspermidine synthase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.25.2380 OR glutathionylspermidine synthase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.25.2430 | LmxM.25.2430.1 | 2 | 1 | 1 | | | forward | protein coding | Yes | 1599 | LmxM.25.2430 | Xaa-Pro aminopeptidase, putative | Xaa-Pro aminopeptidase, putative | | | 25 | LmxM.25:875,108..876,708(+) | LmxM.25:875108..876708(+) | LmxM.25 | Leishmania mexicana MHOM/GT/2001/U1103 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 532 | 1599 | 58715 | 6.38 | 0 | | | | | | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.25.2430ORXaa-Pro aminopeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.25.2430 OR Xaa-Pro aminopeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.26.0300 | LmxM.26.0300.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2664 | LmxM.26.0300 | metallo-peptidase, Clan MA(E), Family M1 | metallo-peptidase, Clan MA(E), Family M1 | | E9AY12 | 26 | LmxM.26:70,989..73,652(-) | LmxM.26:70989..73652(-) | LmxM.26 | Leishmania mexicana MHOM/GT/2001/U1103 | 59 | OG6_100948 | 0 | 887 | 2664 | 98318 | 5.36 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.26.0300ORmetallo-peptidase, Clan MA(E), Family M1ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.26.0300 OR metallo-peptidase, Clan MA(E), Family M1 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.26.1570 | LmxM.26.1570.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2058 | LmxM.26.1570 | thimet oligopeptidase, putative | thimet oligopeptidase, putative | | E9AYD6 | 26 | LmxM.26:549,261..551,318(+) | LmxM.26:549261..551318(+) | LmxM.26 | Leishmania mexicana MHOM/GT/2001/U1103 | 118 | OG6_100561 | 2 | 685 | 2058 | 77044 | 5.74 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.15 (Thimet oligopeptidase) | 3.4.24.15 (Thimet oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.26.1570ORthimet oligopeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.26.1570 OR thimet oligopeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.26.2070 | LmxM.26.2070.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4047 | LmxM.26.2070 | cysteine peptidase, Clan CA, family C48, putative | cysteine peptidase, Clan CA, family C48, putative | | E9AYI7 | 26 | LmxM.26:752,030..756,076(+) | LmxM.26:752030..756076(+) | LmxM.26 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_101235 | 0 | 1348 | 4047 | 143729 | 9.72 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | GO:0005634 | nucleus | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.26.2070ORcysteine peptidase, Clan CA, family C48, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.26.2070 OR cysteine peptidase, Clan CA, family C48, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.26.2420 | LmxM.26.2420.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1935 | LmxM.26.2420 | hypothetical protein, conserved | hypothetical protein, conserved | | E9AYM3 | 26 | LmxM.26:924,978..926,912(+) | LmxM.26:924978..926912(+) | LmxM.26 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_139357 | 0 | 644 | 1935 | 71455 | 7.51 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.26.2420ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.26.2420 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.26.2690 | LmxM.26.2690.1 | 1 | 1 | 1 | | | forward | protein coding | No | 675 | LmxM.26.2690 | peptidase with unknown catalytic mechanism (family U48) | peptidase with unknown catalytic mechanism (family U48) | | E9AYQ0 | 26 | LmxM.26:1,022,831..1,023,505(+) | LmxM.26:1022831..1023505(+) | LmxM.26 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_103186 | 0 | 224 | 675 | 24788 | 7.85 | 2 | NN: MCCVASGAYLAFIAAPLRAA, HMM: MCCVASGAYLAFIAAPLRAA | NN Sum: 3, NN D: .44, HMM Prob: .96 | GO:0016020 | membrane | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.26.2690ORpeptidase with unknown catalytic mechanism (family U48)ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.26.2690 OR peptidase with unknown catalytic mechanism (family U48) AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.0040 | LmxM.27.0040.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1284 | LmxM.27.0040 | metallo- peptidase, Clan M- Family M48 | metallo- peptidase, Clan M- Family M48 | | E9AYQ6 | 27 | LmxM.27:10,515..11,798(-) | LmxM.27:10515..11798(-) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_101632 | 0 | 427 | 1284 | 49294 | 8.51 | 3 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | GO:0004222 | metalloendopeptidase activity | GO:0071586;GO:0006508 | CAAX-box protein processing;proteolysis | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.0040ORmetallo- peptidase, Clan M- Family M48ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.0040 OR metallo- peptidase, Clan M- Family M48 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.0190 | LmxM.27.0190.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 717 | LmxM.27.0190 | proteasome alpha 7 subunit, putative | proteasome alpha 7 subunit, putative | | E9AYS1 | 27 | LmxM.27:43,967..44,683(-) | LmxM.27:43967..44683(-) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_102011 | 0 | 238 | 717 | 25577 | 6.30 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.0190ORproteasome alpha 7 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.0190 OR proteasome alpha 7 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.0460 | LmxM.27.0460.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1908 | LmxM.27.0460 | Vasohibin, putative | Vasohibin, putative | | E9AYU8 | 27 | LmxM.27:127,834..129,741(+) | LmxM.27:127834..129741(+) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_105471 | 0 | 635 | 1908 | 69035 | 9.12 | 0 | | | GO:0005737 | cytoplasm | | | GO:0045765 | regulation of angiogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.0460ORVasohibin, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.0460 OR Vasohibin, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.0490 | LmxM.27.0490.1 | 1 | 1 | 1 | 1 | | forward | protein coding | No | 7066 | LmxM.27.0490 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9AYV1 | 27 | LmxM.27:142,516..149,581(+) | LmxM.27:142516..149580(+) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 315 | OG6_115879 | 2 | 2355 | 7065 | 269055 | 4.95 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0020016;GO:0005737 | ciliary pocket;cytoplasm | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.0490ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.0490 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.0500 | LmxM.27.0500.1 | 1 | 1 | 1 | | | forward | protein coding | Yes | 17262 | LmxM.27.0500 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | | 27 | LmxM.27:163,692..180,953(+) | LmxM.27:163692..180953(+) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 0 | N/A (orthology not determined because poor protein quality) | 0 | 5753 | 17262 | 654106 | 4.94 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 4.6.1.1 (Adenylate cyclase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.0500ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.0500 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.0510 | LmxM.27.0510.1 | 1 | 1 | 1 | | | forward | protein coding | No | 13026 | LmxM.27.0510 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9AYV2 | 27 | LmxM.27:190,107..203,132(+) | LmxM.27:190107..203132(+) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 315 | OG6_115879 | 2 | 4341 | 13026 | 489110 | 5.57 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.0510ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.0510 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.1270 | LmxM.27.1270.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1728 | LmxM.27.1270 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9AZ31 | 27 | LmxM.27:515,416..517,143(+) | LmxM.27:515416..517143(+) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 57 | OG6_101021 | 0 | 575 | 1728 | 65042 | 7.60 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.1270ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.1270 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.27.1870 | LmxM.27.1870.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1959 | LmxM.27.1870 | trypanothione synthetase | trypanothione synthetase | | E9AZ89 | 27 | LmxM.27:782,512..784,470(-) | LmxM.27:782512..784470(-) | LmxM.27 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_111169 | 0 | 652 | 1959 | 74397 | 5.59 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | 3.5.1.78 (Glutathionylspermidine amidase);6.3.1.9 (Trypanothione synthase) | 3.5.1.78 (Glutathionylspermidine amidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.27.1870ORtrypanothione synthetaseANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.27.1870 OR trypanothione synthetase AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.28.0110 | LmxM.28.0110.1 | 1 | 1 | 1 | | | forward | protein coding | No | 618 | LmxM.28.0110 | proteasome beta 3 subunit, putative | proteasome beta 3 subunit, putative | | E9AZH2 | 28 | LmxM.28:31,704..32,321(+) | LmxM.28:31704..32321(+) | LmxM.28 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_101970 | 0 | 205 | 618 | 22521 | 5.84 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.28.0110ORproteasome beta 3 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.28.0110 OR proteasome beta 3 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.28.0570 | LmxM.28.0570.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1701 | LmxM.28.0570 | major surface protease gp63, putative | major surface protease gp63, putative | | E9AZL8 | 28 | LmxM.28:194,846..196,546(-) | LmxM.28:194846..196546(-) | LmxM.28 | Leishmania mexicana MHOM/GT/2001/U1103 | 617 | OG6_101754 | 6 | 566 | 1701 | 61317 | 7.40 | 2 | NN: MSRTLLRITVTFVLVCSVVGVGAVQAH, HMM: MSRTLLRITVTFVLVCSVVGVGAVQAH | NN Sum: 4, NN D: .79, HMM Prob: .97 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | 3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.28.0570ORmajor surface protease gp63, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.28.0570 OR major surface protease gp63, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.28.1950 | LmxM.28.1950.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2061 | LmxM.28.1950 | X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative | X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative | | E9B014 | 28 | LmxM.28:747,178..749,238(-) | LmxM.28:747178..749238(-) | LmxM.28 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_111836 | 0 | 686 | 2061 | 76108 | 5.87 | 0 | | | | | GO:0008239;GO:0016787 | dipeptidyl-peptidase activity;hydrolase activity | | | | | | | | | | 3.1.1.43 (Alpha-amino-acid esterase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.28.1950ORX-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.28.1950 OR X-pro, dipeptidyl-peptidase,serine peptidase, Clan SC, family S15, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.28.2800 | LmxM.28.2800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1497 | LmxM.28.2800 | beta-lactamase, putative | beta-lactamase, putative | | E9B0A2 | 28 | LmxM.28:1,053,393..1,054,889(-) | LmxM.28:1053393..1054889(-) | LmxM.28 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_147553 | 0 | 498 | 1497 | 55632 | 8.84 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.28.2800ORbeta-lactamase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.28.2800 OR beta-lactamase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.29.0050 | LmxM.29.0050.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2289 | LmxM.29.0050 | MATH domain containing protein, putative | MATH domain containing protein, putative | | E9B0D0 | 29 | LmxM.29:10,399..12,687(-) | LmxM.29:10399..12687(-) | LmxM.29 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_134892 | 0 | 762 | 2289 | 86897 | 5.67 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.29.0050ORMATH domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.29.0050 OR MATH domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.29.0250 | LmxM.29.0250.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3384 | LmxM.29.0250 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9B0E9 | 29 | LmxM.29:70,639..74,022(-) | LmxM.29:70639..74022(-) | LmxM.29 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_102772 | 0 | 1127 | 3384 | 126030 | 5.06 | 0 | | | | | GO:0005515 | protein binding | | | | | | | GO:0000289;GO:0010608 | nuclear-transcribed mRNA poly(A) tail shortening;posttranscriptional regulation of gene expression | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.29.0250ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.29.0250 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.29.0270 | LmxM.29.0270.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1185 | LmxM.29.0270 | cysteine peptidase, Clan CA, family C54, putative | cysteine peptidase, Clan CA, family C54, putative | | E9B0F1 | 29 | LmxM.29:79,384..80,568(-) | LmxM.29:79384..80568(-) | LmxM.29 | Leishmania mexicana MHOM/GT/2001/U1103 | 97 | OG6_100501 | 1 | 394 | 1185 | 43845 | 6.24 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.29.0270ORcysteine peptidase, Clan CA, family C54, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.29.0270 OR cysteine peptidase, Clan CA, family C54, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.29.0400 | LmxM.29.0400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1443 | LmxM.29.0400 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | E9B0G4 | 29 | LmxM.29:130,455..131,897(-) | LmxM.29:130455..131897(-) | LmxM.29 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_105308 | 0 | 480 | 1443 | 52170 | 7.88 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.29.0400ORAlpha/beta hydrolase family, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.29.0400 OR Alpha/beta hydrolase family, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.29.0750 | LmxM.29.0750.1 | 1 | 1 | 1 | | | forward | protein coding | No | 591 | LmxM.29.0750 | 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative | 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative | | E9B0K2 | 29 | LmxM.29:233,843..234,433(+) | LmxM.29:233843..234433(+) | LmxM.29 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_101257 | 0 | 196 | 591 | 20670 | 6.67 | 0 | | | | | | | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.29.0750OR4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.29.0750 OR 4-methyl-5(beta-hydroxyethyl)-thiazole monophosphate synthesis protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.29.1380 | LmxM.29.1380.1 | 1 | 1 | 1 | | | forward | protein coding | No | 972 | LmxM.29.1380 | amidohydrolase, putative | amidohydrolase, putative | | E9B0R7 | 29 | LmxM.29:470,462..471,433(+) | LmxM.29:470462..471433(+) | LmxM.29 | Leishmania mexicana MHOM/GT/2001/U1103 | 181 | OG6_101553 | 4 | 323 | 972 | 34739 | 6.28 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.29.1380ORamidohydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.29.1380 OR amidohydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.29.2040 | LmxM.29.2040.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4095 | LmxM.29.2040 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9B0X6 | 29 | LmxM.29:710,576..714,670(+) | LmxM.29:710576..714670(+) | LmxM.29 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_146872 | 0 | 1364 | 4095 | 149550 | 6.36 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005930 | axoneme | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.29.2040ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.29.2040 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0100 | LmxM.30.0100.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1095 | LmxM.30.0100 | metallo-peptidase, Clan MK, Family M67 | metallo-peptidase, Clan MK, Family M67 | | E9B1F8 | 30 | LmxM.30:25,558..26,652(-) | LmxM.30:25558..26652(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_100288 | 0 | 364 | 1095 | 39819 | 7.91 | 0 | | | | | | | | | | | | | | | 3.4.24.57 (O-sialoglycoprotein endopeptidase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0100ORmetallo-peptidase, Clan MK, Family M67ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0100 OR metallo-peptidase, Clan MK, Family M67 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0140 | LmxM.30.0140.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1371 | LmxM.30.0140 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | | E9B1G2 | 30 | LmxM.30:34,642..36,012(-) | LmxM.30:34642..36012(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 58 | OG6_101892 | 0 | 456 | 1371 | 50717 | 6.52 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0140ORubiquitin carboxyl-terminal hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0140 OR ubiquitin carboxyl-terminal hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0390 | LmxM.30.0390.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2355 | LmxM.30.0390 | Calpain-like protein 2 | Calpain-like protein 2 | | E9B1J0 | 30 | LmxM.30:125,343..127,697(-) | LmxM.30:125343..127697(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_156861 | 0 | 784 | 2355 | 89335 | 4.71 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0390ORCalpain-like protein 2ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0390 OR Calpain-like protein 2 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0400 | LmxM.30.0400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2811 | LmxM.30.0400 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9B1J1 | 30 | LmxM.30:128,568..131,378(-) | LmxM.30:128568..131378(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 40 | OG6_200267 | 0 | 936 | 2811 | 103063 | 7.39 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0400ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0400 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0410 | LmxM.30.0410.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2265 | LmxM.30.0410 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9B1J2 | 30 | LmxM.30:135,960..138,224(-) | LmxM.30:135960..138224(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 24 | OG6_478567 | 0 | 754 | 2265 | 82936 | 6.12 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0410ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0410 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0430 | LmxM.30.0430.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2826 | LmxM.30.0430 | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_23:8,561..11,386(+) | 1036_mexFOS1_13k16.p1kpIBF_23:8561..11386(+) | 1036_mexFOS1_13k16.p1kpIBF_23 | Leishmania mexicana MHOM/GT/2001/U1103 | 22 | OG6_200268 | 0 | 941 | 2826 | 101848 | 6.12 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0430ORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0430 OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0440 | LmxM.30.0440.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2175 | LmxM.30.0440 | cytoskeleton-associated protein CAP5.5, putative | cytoskeleton-associated protein CAP5.5, putative | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_23:4,010..6,184(+) | 1036_mexFOS1_13k16.p1kpIBF_23:4010..6184(+) | 1036_mexFOS1_13k16.p1kpIBF_23 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_143858 | 2 | 724 | 2175 | 79840 | 4.84 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0440ORcytoskeleton-associated protein CAP5.5, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0440 OR cytoskeleton-associated protein CAP5.5, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0440b | LmxM.30.0440b.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1338 | LmxM.30.0440b | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_8:2,104..3,441(-) | 1036_mexFOS1_13k16.p1kpIBF_8:2104..3441(-) | 1036_mexFOS1_13k16.p1kpIBF_8 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_143858 | 2 | 445 | 1338 | 49307 | 4.87 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0440bORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0440b OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460 | LmxM.30.0460.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2127 | LmxM.30.0460 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9B1J6 | 30 | LmxM.30:161,516..163,642(-) | LmxM.30:161516..163642(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 708 | 2127 | 79485 | 9.71 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460a | LmxM.30.0460a.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2361 | LmxM.30.0460a | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_23:12,657..15,017(+) | 1036_mexFOS1_13k16.p1kpIBF_23:12657..15017(+) | 1036_mexFOS1_13k16.p1kpIBF_23 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 786 | 2361 | 87965 | 9.68 | 1 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460aORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460a OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460b | LmxM.30.0460b.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1527 | LmxM.30.0460b | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_13:3,979..5,505(+) | 1036_mexFOS1_13k16.p1kpIBF_13:3979..5505(+) | 1036_mexFOS1_13k16.p1kpIBF_13 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 508 | 1527 | 56995 | 10.01 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460bORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460b OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460c | LmxM.30.0460c.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2127 | LmxM.30.0460c | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_63:9,781..11,907(-) | 1036_mexFOS1_13k16.p1kpIBF_63:9781..11907(-) | 1036_mexFOS1_13k16.p1kpIBF_63 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 708 | 2127 | 79501 | 9.78 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460cORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460c OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460d | LmxM.30.0460d.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1746 | LmxM.30.0460d | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_66:1,669..3,414(-) | 1036_mexFOS1_13k16.p1kpIBF_66:1669..3414(-) | 1036_mexFOS1_13k16.p1kpIBF_66 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 581 | 1746 | 65010 | 9.90 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460dORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460d OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460e | LmxM.30.0460e.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2127 | LmxM.30.0460e | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_62:3,954..6,080(-) | 1036_mexFOS1_13k16.p1kpIBF_62:3954..6080(-) | 1036_mexFOS1_13k16.p1kpIBF_62 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 708 | 2127 | 79452 | 9.79 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460eORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460e OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460f | LmxM.30.0460f.1 | 1 | 1 | 1 | | | forward | protein coding | No | 324 | LmxM.30.0460f | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_36:3..326(+) | 1036_mexFOS1_13k16.p1kpIBF_36:3..326(+) | 1036_mexFOS1_13k16.p1kpIBF_36 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 107 | 324 | 11913 | 10.23 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460fORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460f OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.0460g | LmxM.30.0460g.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 840 | LmxM.30.0460g | hypothetical protein | hypothetical protein | | | Not Assigned | 1036_mexFOS1_13k16.p1kpIBF_53:3,313..4,152(-) | 1036_mexFOS1_13k16.p1kpIBF_53:3313..4152(-) | 1036_mexFOS1_13k16.p1kpIBF_53 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_104309 | 7 | 279 | 840 | 31607 | 10.49 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.0460gORhypothetical proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.0460g OR hypothetical protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.1130 | LmxM.30.1130.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1218 | LmxM.30.1130 | amidohydrolase, putative | amidohydrolase, putative | | E9B1R0 | 30 | LmxM.30:436,719..437,936(-) | LmxM.30:436719..437936(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 181 | OG6_101553 | 4 | 405 | 1218 | 43842 | 5.58 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | 3.5.1.14 (N-acyl-aliphatic-L-amino acid amidohydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.1130ORamidohydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.1130 OR amidohydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.1140 | LmxM.30.1140.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 936 | LmxM.30.1140 | monoglyceride lipase, putative | monoglyceride lipase, putative | | E9B1R1 | 30 | LmxM.30:439,481..440,416(-) | LmxM.30:439481..440416(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 81 | OG6_100231 | 0 | 311 | 936 | 34656 | 7.29 | 0 | | | | | | | | | GO:0005737;GO:0020015 | cytoplasm;glycosome | | | | | 3.1.1.23 (Acylglycerol lipase) | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.1140ORmonoglyceride lipase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.1140 OR monoglyceride lipase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.1890 | LmxM.30.1890.1 | 1 | 1 | 1 | 2 | | reverse | protein coding | No | 1028 | LmxM.30.1890 | peptidase m20/m25/m40 family-like protein | peptidase m20/m25/m40 family-like protein | | E9B1Y8 | 30 | LmxM.30:906,774..907,801(-) | LmxM.30:906776..907801(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 93 | OG6_100503 | 2 | 342 | 1026 | 37403 | 4.87 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.1890ORpeptidase m20/m25/m40 family-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.1890 OR peptidase m20/m25/m40 family-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.2000 | LmxM.30.2000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1908 | LmxM.30.2000 | metallo-peptidase, Clan MA(M), Family M8 | metallo-peptidase, Clan MA(M), Family M8 | | E9B1Z9 | 30 | LmxM.30:955,275..957,182(-) | LmxM.30:955275..957182(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 44 | OG6_101184 | 0 | 635 | 1908 | 66822 | 7.36 | 1 | HMM: MSHVPAALWRIALWLSALLIYAAFTTVAA, NN: MSHVPAALWRIALWLSALLIYAAFTTVAA | NN Sum: 4, NN D: .71, HMM Prob: 1 | GO:0016020 | membrane | GO:0004222 | metalloendopeptidase activity | GO:0007155;GO:0006508 | cell adhesion;proteolysis | | | | | | | 3.4.24.36 (Leishmanolysin) | 3.4.24.36 (Leishmanolysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.2000ORmetallo-peptidase, Clan MA(M), Family M8ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.2000 OR metallo-peptidase, Clan MA(M), Family M8 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.2020 | LmxM.30.2020.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1416 | LmxM.30.2020 | succinyl-diaminopimelate desuccinylase-like protein | succinyl-diaminopimelate desuccinylase-like protein | | E9B201 | 30 | LmxM.30:964,921..966,336(-) | LmxM.30:964921..966336(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 93 | OG6_100503 | 2 | 471 | 1416 | 51110 | 5.07 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | | | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.2020ORsuccinyl-diaminopimelate desuccinylase-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.2020 OR succinyl-diaminopimelate desuccinylase-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.2260 | LmxM.30.2260.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1866 | LmxM.30.2260 | aminopeptidase, putative | aminopeptidase, putative | | E9B227 | 30 | LmxM.30:1,092,064..1,093,929(-) | LmxM.30:1092064..1093929(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 55 | OG6_158281 | 0 | 621 | 1866 | 66228 | 6.59 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.2260ORaminopeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.2260 OR aminopeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.2970 | LmxM.30.2970.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 6504 | LmxM.30.2970 | acetyl-CoA carboxylase | acetyl-CoA carboxylase | | E9B297 | 30 | LmxM.30:1,352,711..1,359,214(-) | LmxM.30:1352711..1359214(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 74 | OG6_101052 | 0 | 2167 | 6504 | 241281 | 6.50 | 0 | | | | | GO:0005524;GO:0003989;GO:0016874;GO:0046872 | ATP binding;acetyl-CoA carboxylase activity;ligase activity;metal ion binding | GO:0006633 | fatty acid biosynthetic process | GO:0009343;GO:0005737;GO:0020015 | biotin carboxylase complex;cytoplasm;glycosome | GO:0005524;GO:0003989;GO:0004075 | ATP binding;acetyl-CoA carboxylase activity;biotin carboxylase activity | GO:0030497;GO:0009372 | fatty acid elongation;quorum sensing | 6.4.1.2 (Acetyl-CoA carboxylase) | 6.4.1.2 (Acetyl-CoA carboxylase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.2970ORacetyl-CoA carboxylaseANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.2970 OR acetyl-CoA carboxylase AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.30.3090 | LmxM.30.3090.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3243 | LmxM.30.3090 | peptidase, putative | peptidase, putative | | E9B2A8 | 30 | LmxM.30:1,403,016..1,406,258(-) | LmxM.30:1403016..1406258(-) | LmxM.30 | Leishmania mexicana MHOM/GT/2001/U1103 | 59 | OG6_100422 | 0 | 1080 | 3243 | 118626 | 4.83 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.30.3090ORpeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.30.3090 OR peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.0390 | LmxM.31.0390.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1080 | LmxM.31.0390 | 19S proteasome non-atpase subunit 8 | 19S proteasome non-atpase subunit 8 | | E9B2G0 | 31 | LmxM.31:139,471..140,550(-) | LmxM.31:139471..140550(-) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_102054 | 0 | 359 | 1080 | 40099 | 5.08 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005838 | proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.0390OR19S proteasome non-atpase subunit 8ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.0390 OR 19S proteasome non-atpase subunit 8 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.0970 | LmxM.31.0970.1 | 1 | 1 | 1 | | | forward | protein coding | No | 5673 | LmxM.31.0970 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9B2M1 | 31 | LmxM.31:360,700..366,372(+) | LmxM.31:360700..366372(+) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_147050 | 0 | 1890 | 5673 | 200656 | 6.66 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.0970ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.0970 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.1250 | LmxM.31.1250.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1230 | LmxM.31.1250 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9B2Q0 | 31 | LmxM.31:477,012..478,241(+) | LmxM.31:477012..478241(+) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_103260 | 0 | 409 | 1230 | 45578 | 7.72 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.1250ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.1250 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.1310 | LmxM.31.1310.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1158 | LmxM.31.1310 | WLM domain containing protein, putative | WLM domain containing protein, putative | | E9B2Q6 | 31 | LmxM.31:501,039..502,196(+) | LmxM.31:501039..502196(+) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 26 | OG6_198984 | 0 | 385 | 1158 | 41857 | 6.62 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.1310ORWLM domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.1310 OR WLM domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.1330 | LmxM.31.1330.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1893 | LmxM.31.1330 | PPPDE putative peptidase domain containing protein, putative | PPPDE putative peptidase domain containing protein, putative | | E9B2Q8 | 31 | LmxM.31:505,766..507,658(+) | LmxM.31:505766..507658(+) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_146568 | 0 | 630 | 1893 | 69878 | 8.95 | 0 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.1330ORPPPDE putative peptidase domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.1330 OR PPPDE putative peptidase domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.1500 | LmxM.31.1500.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2160 | LmxM.31.1500 | Metalloprotease M41 FtsH, putative | Metalloprotease M41 FtsH, putative | | E9B2S6 | 31 | LmxM.31:580,182..582,341(-) | LmxM.31:580182..582341(-) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_134869 | 0 | 719 | 2160 | 78201 | 8.56 | 1 | | | | | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005739 | mitochondrion | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.1500ORMetalloprotease M41 FtsH, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.1500 OR Metalloprotease M41 FtsH, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.2910 | LmxM.31.2910.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4023 | LmxM.31.2910 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9B371 | 31 | LmxM.31:1,137,980..1,142,002(-) | LmxM.31:1137980..1142002(-) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_146381 | 0 | 1340 | 4023 | 148049 | 4.86 | 0 | | | | | GO:0004843;GO:0036459 | thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | GO:0005737 | cytoplasm | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.2910ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.2910 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.3680 | LmxM.31.3680.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1116 | LmxM.31.3680 | enoyl-CoA hydratase/isomerase family protein, putative | enoyl-CoA hydratase/isomerase family protein, putative | | E9B3E6 | 31 | LmxM.31:1,419,819..1,420,934(+) | LmxM.31:1419819..1420934(+) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 65 | OG6_102025 | 0 | 371 | 1116 | 40222 | 6.93 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | GO:0097014;GO:0005737;GO:0005739;GO:0031981 | ciliary plasm;cytoplasm;mitochondrion;nuclear lumen | | | | | 4.2.1.17 (Enoyl-CoA hydratase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.3680ORenoyl-CoA hydratase/isomerase family protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.3680 OR enoyl-CoA hydratase/isomerase family protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.31.3890 | LmxM.31.3890.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1167 | LmxM.31.3890 | cysteine peptidase, Clan CA, family C54, putative | cysteine peptidase, Clan CA, family C54, putative | | E9B3G7 | 31 | LmxM.31:1,475,731..1,476,897(+) | LmxM.31:1475731..1476897(+) | LmxM.31 | Leishmania mexicana MHOM/GT/2001/U1103 | 97 | OG6_100501 | 1 | 388 | 1167 | 42639 | 8.21 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.31.3890ORcysteine peptidase, Clan CA, family C54, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.31.3890 OR cysteine peptidase, Clan CA, family C54, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.0200 | LmxM.32.0200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 4452 | LmxM.32.0200 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | E9B3J8 | 32 | LmxM.32:45,864..50,315(-) | LmxM.32:45864..50315(-) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_101273 | 0 | 1483 | 4452 | 160770 | 7.51 | 0 | NN: MVQGMLFSSLQSGSAAD, HMM: MVQGMLFSSLQSGSAAD | NN Sum: 2, NN D: .34, HMM Prob: .81 | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | 3.4.17.10 (Carboxypeptidase E) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.0200ORmetallo-peptidase, Clan MC, Family M14, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.0200 OR metallo-peptidase, Clan MC, Family M14, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.0400 | LmxM.32.0400.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1221 | LmxM.32.0400 | serine peptidase, putative | serine peptidase, putative | | E9B3L8 | 32 | LmxM.32:127,905..129,125(-) | LmxM.32:127905..129125(-) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 86 | OG6_100915 | 1 | 406 | 1221 | 44855 | 6.94 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.0400ORserine peptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.0400 OR serine peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.1610 | LmxM.32.1610.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1419 | LmxM.32.1610 | cytosolic nonspecific dipeptidase, putative | cytosolic nonspecific dipeptidase, putative | | E9B3Z8 | 32 | LmxM.32:633,681..635,099(+) | LmxM.32:633681..635099(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 93 | OG6_100503 | 2 | 472 | 1419 | 51682 | 5.77 | 0 | | | | | GO:0016787 | hydrolase activity | GO:0008152 | metabolic process | GO:0005737 | cytoplasm | | | | | | 3.4.13.20 (Beta-Ala-His dipeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.1610ORcytosolic nonspecific dipeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.1610 OR cytosolic nonspecific dipeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.1800 | LmxM.32.1800.1 | 1 | 1 | 1 | | | forward | protein coding | No | 648 | LmxM.32.1800 | Der1-like family, putative | Der1-like family, putative | | E9B416 | 32 | LmxM.32:690,499..691,146(+) | LmxM.32:690499..691146(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 95 | OG6_101672 | 1 | 215 | 648 | 24763 | 7.96 | 4 | | | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.1800ORDer1-like family, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.1800 OR Der1-like family, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2010 | LmxM.32.2010.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4140 | LmxM.32.2010 | calpain protease-like protein | calpain protease-like protein | | E9B439 | 32 | LmxM.32:766,143..770,282(+) | LmxM.32:766143..770282(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_103851 | 0 | 1379 | 4140 | 150753 | 8.28 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.17 (Transferred entry: 3.4.22.52 and 3.4.22.53) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2010ORcalpain protease-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2010 OR calpain protease-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2260 | LmxM.32.2260.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4302 | LmxM.32.2260 | glycosyl hydrolase-like protein | glycosyl hydrolase-like protein | | E9B465 | 32 | LmxM.32:890,978..895,279(+) | LmxM.32:890978..895279(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_104188 | 0 | 1433 | 4302 | 154360 | 6.90 | 0 | | | GO:0005737 | cytoplasm | GO:0033925 | mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity | | | | | | | | | | 3.2.1.96 (Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2260ORglycosyl hydrolase-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2260 OR glycosyl hydrolase-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2540 | LmxM.32.2540.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1500 | LmxM.32.2540 | metallo-peptidase, Clan MA(E) Family M32 | metallo-peptidase, Clan MA(E) Family M32 | | E9B493 | 32 | LmxM.32:1,011,337..1,012,836(+) | LmxM.32:1011337..1012836(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 154 | OG6_105939 | 1 | 499 | 1500 | 56957 | 5.52 | 0 | | | | | GO:0004181 | metallocarboxypeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0004181 | metallocarboxypeptidase activity | GO:0006518;GO:0006508 | peptide metabolic process;proteolysis | 3.4.17.19 (Carboxypeptidase Taq) | 3.4.17.19 (Carboxypeptidase Taq) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2540ORmetallo-peptidase, Clan MA(E) Family M32ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2540 OR metallo-peptidase, Clan MA(E) Family M32 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2570 | LmxM.32.2570.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1584 | LmxM.32.2570 | metallo-peptidase, Clan MF, Family M17 | metallo-peptidase, Clan MF, Family M17 | | E9B496 | 32 | LmxM.32:1,028,165..1,029,748(+) | LmxM.32:1028165..1029748(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_105603 | 0 | 527 | 1584 | 55902 | 6.94 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | GO:0005654;GO:0005634 | nucleoplasm;nucleus | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2570ORmetallo-peptidase, Clan MF, Family M17ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2570 OR metallo-peptidase, Clan MF, Family M17 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2610 | LmxM.32.2610.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1452 | LmxM.32.2610 | Mitochondrial-processing peptidase subunit alpha | Mitochondrial-processing peptidase subunit alpha | | E9B4A1 | 32 | LmxM.32:1,042,904..1,044,355(+) | LmxM.32:1042904..1044355(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_102381 | 0 | 483 | 1452 | 53211 | 7.00 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0017087 | cytoplasm;mitochondrial processing peptidase complex | GO:0004222 | metalloendopeptidase activity | GO:0030150 | protein import into mitochondrial matrix | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2610ORMitochondrial-processing peptidase subunit alphaANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2610 OR Mitochondrial-processing peptidase subunit alpha AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2830 | LmxM.32.2830.1 | 1 | 1 | 1 | | | forward | protein coding | No | 711 | LmxM.32.2830 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | E9B4C3 | 32 | LmxM.32:1,152,140..1,152,850(+) | LmxM.32:1152140..1152850(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 102 | OG6_115782 | 1 | 236 | 711 | 26444 | 7.91 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2830ORcysteine peptidase, Clan CA, family C51, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2830 OR cysteine peptidase, Clan CA, family C51, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2850 | LmxM.32.2850.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1155 | LmxM.32.2850 | cysteine peptidase, Clan CA, family C51, putative | cysteine peptidase, Clan CA, family C51, putative | | E9B4C6 | 32 | LmxM.32:1,163,065..1,164,219(+) | LmxM.32:1163065..1164219(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 102 | OG6_115782 | 1 | 384 | 1155 | 41616 | 8.21 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2850ORcysteine peptidase, Clan CA, family C51, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2850 OR cysteine peptidase, Clan CA, family C51, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.2860 | LmxM.32.2860.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1461 | LmxM.32.2860 | hypothetical protein, conserved | hypothetical protein, conserved | | E9B4C7 | 32 | LmxM.32:1,165,879..1,167,339(+) | LmxM.32:1165879..1167339(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 44 | OG6_173752 | 0 | 486 | 1461 | 53172 | 9.08 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.2860ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.2860 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.32.3130 | LmxM.32.3130.1 | 1 | 1 | 1 | | | forward | protein coding | No | 924 | LmxM.32.3130 | Trypsin-like peptidase domain containing protein, putative | Trypsin-like peptidase domain containing protein, putative | | E9B4F2 | 32 | LmxM.32:1,367,871..1,368,794(+) | LmxM.32:1367871..1368794(+) | LmxM.32 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_137919 | 0 | 307 | 924 | 32750 | 7.09 | 0 | NN: MVEGAAAAAAAGAGALAVASQRSGCCFPILSFLHVPGKMAK, HMM: MVEGAAAAAAAGAGALAV | NN Sum: 1, NN D: .29, HMM Prob: .98 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.32.3130ORTrypsin-like peptidase domain containing protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.32.3130 OR Trypsin-like peptidase domain containing protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.0280 | LmxM.33.0280.1 | 1 | 1 | 1 | | | forward | protein coding | No | 4662 | LmxM.33.0280 | cysteine peptidase, Clan CA, family C2, putative | cysteine peptidase, Clan CA, family C2, putative | | E9B4J6 | 33 | LmxM.33:95,058..99,719(+) | LmxM.33:95058..99719(+) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 26 | OG6_200421 | 0 | 1553 | 4662 | 172618 | 8.23 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.0280ORcysteine peptidase, Clan CA, family C2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.0280 OR cysteine peptidase, Clan CA, family C2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.0650 | LmxM.33.0650.1 | 1 | 1 | 1 | | | forward | protein coding | No | 930 | LmxM.33.0650 | proteasome regulatory non-ATPase subunit 11, putative | proteasome regulatory non-ATPase subunit 11, putative | | E9B4N4 | 33 | LmxM.33:273,132..274,061(+) | LmxM.33:273132..274061(+) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 58 | OG6_101835 | 0 | 309 | 930 | 34739 | 7.04 | 0 | | | | | GO:0005515 | protein binding | | | GO:0005737;GO:0005838 | cytoplasm;proteasome regulatory particle | | | GO:0016049;GO:0006511 | cell growth;ubiquitin-dependent protein catabolic process | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.0650ORproteasome regulatory non-ATPase subunit 11, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.0650 OR proteasome regulatory non-ATPase subunit 11, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.1060 | LmxM.33.1060.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1872 | LmxM.33.1060 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | E9B4S8 | 33 | LmxM.33:452,558..454,429(+) | LmxM.33:452558..454429(+) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_100384 | 0 | 623 | 1872 | 69242 | 7.63 | 2 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.1060ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.1060 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.2000 | LmxM.33.2000.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 834 | LmxM.33.2000 | pyroglutamyl-peptidase I, putative | pyroglutamyl-peptidase I, putative | | E9B4Y5 | 33 | LmxM.33:693,151..693,984(-) | LmxM.33:693151..693984(-) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_101530 | 0 | 277 | 834 | 30723 | 5.36 | 0 | | | | | | | | | GO:0005737 | cytoplasm | GO:0016920 | pyroglutamyl-peptidase activity | | | | 3.4.19.3 (Pyroglutamyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.2000ORpyroglutamyl-peptidase I, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.2000 OR pyroglutamyl-peptidase I, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.2810 | LmxM.33.2810.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2655 | LmxM.33.2810 | Carboxypeptidase-like protein | Carboxypeptidase-like protein | | E9B572 | 33 | LmxM.33:1,100,825..1,103,479(+) | LmxM.33:1100825..1103479(+) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_105780 | 0 | 884 | 2655 | 96012 | 9.12 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737;GO:0005829 | cytoplasm;cytosol | GO:0043531;GO:0005524;GO:0004181;GO:0008270 | ADP binding;ATP binding;metallocarboxypeptidase activity;zinc ion binding | | | 3.4.17.- (Metallocarboxypeptidases.) | 3.4.17.- (Metallocarboxypeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.2810ORCarboxypeptidase-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.2810 OR Carboxypeptidase-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.4000 | LmxM.33.4000.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1521 | LmxM.33.4000 | Peptidase family C78, putative | Peptidase family C78, putative | | E9B5J5 | 33 | LmxM.33:1,521,359..1,522,879(+) | LmxM.33:1521359..1522879(+) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_102601 | 0 | 506 | 1521 | 55837 | 6.82 | 0 | | | | | | | | | GO:0005634 | nucleus | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.4000ORPeptidase family C78, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.4000 OR Peptidase family C78, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.4060 | LmxM.33.4060.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2721 | LmxM.33.4060 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9B5K1 | 33 | LmxM.33:1,534,217..1,536,937(+) | LmxM.33:1534217..1536937(+) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 45 | OG6_173868 | 0 | 906 | 2721 | 102485 | 5.40 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.4060ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.4060 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.33.4340 | LmxM.33.4340.1 | 1 | 1 | 1 | | | forward | protein coding | No | 663 | LmxM.33.4340 | 20s proteasome beta 7 subunit, (putative) | 20s proteasome beta 7 subunit, (putative) | | E9B5M9 | 33 | LmxM.33:1,618,392..1,619,054(+) | LmxM.33:1618392..1619054(+) | LmxM.33 | Leishmania mexicana MHOM/GT/2001/U1103 | 62 | OG6_101718 | 0 | 220 | 663 | 24647 | 4.81 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0097014;GO:0005737;GO:0031981;GO:0019774 | ciliary plasm;cytoplasm;nuclear lumen;proteasome core complex, beta-subunit complex | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.33.4340OR20s proteasome beta 7 subunit, (putative)ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.33.4340 OR 20s proteasome beta 7 subunit, (putative) AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.1380 | LmxM.34.1380.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1473 | LmxM.34.1380 | mitochondrial processing peptidase, beta subunit, putative | mitochondrial processing peptidase, beta subunit, putative | | E9B617 | 34 | LmxM.34:511,999..513,471(+) | LmxM.34:511999..513471(+) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_137602 | 0 | 490 | 1473 | 54641 | 7.05 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.1380ORmitochondrial processing peptidase, beta subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.1380 OR mitochondrial processing peptidase, beta subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.1390 | LmxM.34.1390.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2034 | LmxM.34.1390 | Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative | Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative | | E9B618 | 34 | LmxM.34:516,823..518,856(+) | LmxM.34:516823..518856(+) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_124705 | 0 | 677 | 2034 | 74388 | 8.12 | 0 | | | | | | | | | GO:0051286 | cell tip | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.1390ORZn-finger in Ran binding protein and others/OTU-like cysteine protease, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.1390 OR Zn-finger in Ran binding protein and others/OTU-like cysteine protease, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.1580 | LmxM.34.1580.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1323 | LmxM.34.1580 | metacaspase, putative | metacaspase, putative | | E9B636 | 34 | LmxM.34:595,327..596,649(-) | LmxM.34:595327..596649(-) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 158 | OG6_101407 | 0 | 440 | 1323 | 48184 | 8.52 | 1 | HMM: MADFLDILGIGAVATLIPMLANGL, NN: MADFLDILGIGAVATLIPMLANGL | NN Sum: 4, NN D: .56, HMM Prob: .39 | | | | | | | GO:0051286;GO:0097014;GO:0005737;GO:0031981 | cell tip;ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.1580ORmetacaspase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.1580 OR metacaspase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.1740 | LmxM.34.1740.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3495 | LmxM.34.1740 | ubiquitin hydrolase, putative | ubiquitin hydrolase, putative | | E9B651 | 34 | LmxM.34:644,771..648,265(-) | LmxM.34:644771..648265(-) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_101317 | 0 | 1164 | 3495 | 133387 | 6.87 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.1740ORubiquitin hydrolase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.1740 OR ubiquitin hydrolase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.1980 | LmxM.34.1980.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1767 | LmxM.34.1980 | hypothetical protein, conserved | hypothetical protein, conserved | | E9B676 | 34 | LmxM.34:709,443..711,209(+) | LmxM.34:709443..711209(+) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 54 | OG6_124708 | 0 | 588 | 1767 | 67327 | 6.71 | 0 | | | | | | | | | GO:0030964;GO:0005739 | NADH dehydrogenase complex;mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.1980ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.1980 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.2350 | LmxM.34.2350.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1455 | LmxM.34.2350 | aminopeptidase P, putative | aminopeptidase P, putative | | E9B6B5 | 34 | LmxM.34:878,263..879,717(+) | LmxM.34:878263..879717(+) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 54 | OG6_102295 | 0 | 484 | 1455 | 53780 | 5.53 | 0 | | | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | GO:0005737 | cytoplasm | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.2350ORaminopeptidase P, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.2350 OR aminopeptidase P, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.2410 | LmxM.34.2410.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2769 | LmxM.34.2410 | ubiquitin hydrolase, putative,cysteine peptidase, Clan CA, family C19, putative | ubiquitin hydrolase, putative,cysteine peptidase, Clan CA, family C19, putative | | E9B6C1 | 34 | LmxM.34:908,625..911,393(+) | LmxM.34:908625..911393(+) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_136424 | 0 | 922 | 2769 | 98866 | 8.67 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.2410ORubiquitin hydrolase, putative,cysteine peptidase, Clan CA, family C19, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.2410 OR ubiquitin hydrolase, putative,cysteine peptidase, Clan CA, family C19, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.2800 | LmxM.34.2800.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1203 | LmxM.34.2800 | Alpha/beta hydrolase family, putative | Alpha/beta hydrolase family, putative | | E9B6F9 | 34 | LmxM.34:1,059,219..1,060,421(-) | LmxM.34:1059219..1060421(-) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_138036 | 0 | 400 | 1203 | 44155 | 8.55 | 4 | HMM: MIFGSALVVVVAAINSSAN, NN: MIFGSALVVVVAAINSSAN | NN Sum: 2, NN D: .47, HMM Prob: .87 | | | | | | | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.2800ORAlpha/beta hydrolase family, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.2800 OR Alpha/beta hydrolase family, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.3450 | LmxM.34.3450.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2523 | LmxM.34.3450 | DNA-repair protein, putative | DNA-repair protein, putative | | E9B6M4 | 34 | LmxM.34:1,310,730..1,313,252(-) | LmxM.34:1310730..1313252(-) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_144738 | 0 | 840 | 2523 | 93294 | 9.62 | 0 | | | | | GO:0003677 | DNA binding | | | GO:0005737;GO:0031981;GO:0005634 | cytoplasm;nuclear lumen;nucleus | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.3450ORDNA-repair protein, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.3450 OR DNA-repair protein, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.3840 | LmxM.34.3840.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 765 | LmxM.34.3840 | proteasome beta 2 subunit, putative | proteasome beta 2 subunit, putative | | E9B6R2 | 34 | LmxM.34:1,428,252..1,429,016(-) | LmxM.34:1428252..1429016(-) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_101382 | 0 | 254 | 765 | 27548 | 6.30 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.3840ORproteasome beta 2 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.3840 OR proteasome beta 2 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.4020 | LmxM.34.4020.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1185 | LmxM.34.4020 | Serine peptidase, Clan SC, Family S09X | Serine peptidase, Clan SC, Family S09X | | E9B6T0 | 34 | LmxM.34:1,505,666..1,506,850(+) | LmxM.34:1505666..1506850(+) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_101827 | 0 | 394 | 1185 | 42873 | 6.94 | 1 | NN: MSFGGFLLSAGLYLVLVAVFVSLFLHIMSY, HMM: MSFGGFLLSAGLYLVLVAVFVSLFLHIMSY | NN Sum: 3, NN D: .65, HMM Prob: .29 | | | | | | | GO:0005783 | endoplasmic reticulum | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.4020ORSerine peptidase, Clan SC, Family S09XANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.4020 OR Serine peptidase, Clan SC, Family S09X AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.34.4850 | LmxM.34.4850.1 | 1 | 1 | 1 | | | forward | protein coding | No | 753 | LmxM.34.4850 | proteasome alpha 1 subunit, putative | proteasome alpha 1 subunit, putative | | E9B713 | 34 | LmxM.34:1,773,429..1,774,181(+) | LmxM.34:1773429..1774181(+) | LmxM.34 | Leishmania mexicana MHOM/GT/2001/U1103 | 48 | OG6_102240 | 0 | 250 | 753 | 27265 | 6.77 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737 | cytoplasm | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.34.4850ORproteasome alpha 1 subunit, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.34.4850 OR proteasome alpha 1 subunit, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.0200 | LmxM.36.0200.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 678 | LmxM.36.0200 | serine peptidase clan SF, family S26B, putative | serine peptidase clan SF, family S26B, putative | | E9ASD7 | 20 | LmxM.20:56,414..57,091(-) | LmxM.20:56414..57091(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 47 | OG6_132331 | 0 | 225 | 678 | 25481 | 7.36 | 0 | HMM: MPWRQWWSTLRCSKYGDVPFMLLGVFIGWNCDVSCAV, NN: MPWRQWWSTLRCSKYGDVPFMLLGVFIGWNCDVSCAV | NN Sum: 2, NN D: .39, HMM Prob: .72 | | | | | | | GO:0020023;GO:0005739 | kinetoplast;mitochondrion | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.0200ORserine peptidase clan SF, family S26B, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.0200 OR serine peptidase clan SF, family S26B, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.0320 | LmxM.36.0320.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 621 | LmxM.36.0320 | proteasome subunit beta type-2, putative | proteasome subunit beta type-2, putative | | E9ASE9 | 20 | LmxM.20:84,824..85,444(-) | LmxM.20:84824..85444(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_102061 | 0 | 206 | 621 | 22974 | 6.00 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | GO:0005737 | cytoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.0320ORproteasome subunit beta type-2, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.0320 OR proteasome subunit beta type-2, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.0780 | LmxM.36.0780.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3216 | LmxM.36.0780 | Calpain family cysteine protease, putative | Calpain family cysteine protease, putative | | E9ASJ8 | 20 | LmxM.20:267,881..271,096(+) | LmxM.20:267881..271096(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 25 | OG6_478742 | 0 | 1071 | 3216 | 115843 | 6.48 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.0780ORCalpain family cysteine protease, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.0780 OR Calpain family cysteine protease, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.1380 | LmxM.36.1380.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1869 | LmxM.36.1380 | hypothetical protein, conserved | hypothetical protein, conserved | | E9ASQ7 | 20 | LmxM.20:496,035..497,903(-) | LmxM.20:496035..497903(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_146679 | 0 | 622 | 1869 | 68448 | 6.81 | 0 | HMM: MWLSEWFSALFILIGHDAHVQVTACLFPCALAH, NN: MWLSEWFSALFILIGHDAHVQVTACLFPCALAH | NN Sum: 4, NN D: .48, HMM Prob: .99 | | | GO:0005488 | binding | | | GO:0005739 | mitochondrion | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.1380ORhypothetical protein, conservedANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.1380 OR hypothetical protein, conserved AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.1600 | LmxM.36.1600.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 795 | LmxM.36.1600 | proteasome subunit alpha type-1, putative | proteasome subunit alpha type-1, putative | | E9AST1 | 20 | LmxM.20:607,253..608,047(-) | LmxM.20:607253..608047(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_102143 | 0 | 264 | 795 | 29755 | 4.79 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | GO:0005737;GO:0005654 | cytoplasm;nucleoplasm | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.1600ORproteasome subunit alpha type-1, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.1600 OR proteasome subunit alpha type-1, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.1650 | LmxM.36.1650.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 909 | LmxM.36.1650 | proteasome subunit beta type-5, putative | proteasome subunit beta type-5, putative | | E9AST7 | 20 | LmxM.20:639,907..640,815(-) | LmxM.20:639907..640815(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 52 | OG6_100897 | 0 | 302 | 909 | 33613 | 6.50 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.1650ORproteasome subunit beta type-5, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.1650 OR proteasome subunit beta type-5, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.1690 | LmxM.36.1690.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 927 | LmxM.36.1690 | Peptidase M76 family, putative | Peptidase M76 family, putative | | E9ASU1 | 20 | LmxM.20:650,917..651,843(-) | LmxM.20:650917..651843(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_102968 | 0 | 308 | 927 | 33522 | 7.67 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | | | GO:0005737 | cytoplasm | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.1690ORPeptidase M76 family, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.1690 OR Peptidase M76 family, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.2420 | LmxM.36.2420.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2559 | LmxM.36.2420 | serine peptidase, Clan SC, Family S9B | serine peptidase, Clan SC, Family S9B | | E9AT19 | 20 | LmxM.20:969,278..971,836(+) | LmxM.20:969278..971836(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 57 | OG6_102236 | 0 | 852 | 2559 | 94622 | 6.02 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | GO:0097014;GO:0005737 | ciliary plasm;cytoplasm | | | | | | 3.4.14.5 (Dipeptidyl-peptidase IV) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.2420ORserine peptidase, Clan SC, Family S9BANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.2420 OR serine peptidase, Clan SC, Family S9B AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.2710 | LmxM.36.2710.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1716 | LmxM.36.2710 | mitochondrial ATP-dependent zinc metallopeptidase, putative | mitochondrial ATP-dependent zinc metallopeptidase, putative | | E9AT49 | 20 | LmxM.20:1,090,117..1,091,832(-) | LmxM.20:1090117..1091832(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_101196 | 0 | 571 | 1716 | 62206 | 5.37 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | GO:0005737;GO:0005739 | cytoplasm;mitochondrion | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.2710ORmitochondrial ATP-dependent zinc metallopeptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.2710 OR mitochondrial ATP-dependent zinc metallopeptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.2840 | LmxM.36.2840.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3438 | LmxM.36.2840 | Flagellar Member 2 | Flagellar Member 2 | | E9AT61 | 20 | LmxM.20:1,142,481..1,145,918(-) | LmxM.20:1142481..1145918(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 53 | OG6_146571 | 0 | 1145 | 3438 | 125970 | 5.52 | 0 | | | | | | | | | GO:0005930;GO:0031514 | axoneme;motile cilium | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.2840ORFlagellar Member 2ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.2840 OR Flagellar Member 2 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.3990 | LmxM.36.3990.1 | 1 | 1 | 1 | | | forward | protein coding | No | 681 | LmxM.36.3990 | ATP-dependent protease subunit HslV, putative | ATP-dependent protease subunit HslV, putative | | E9ATI1 | 20 | LmxM.20:1,503,293..1,503,973(+) | LmxM.20:1503293..1503973(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_107204 | 0 | 226 | 681 | 24693 | 6.12 | 0 | NN: MFRRLATRSTSFVTGAAVQAR, HMM: MFRRLATRSTSFVTGAAVQAR | NN Sum: 0, NN D: .37, HMM Prob: .8 | GO:0009376;GO:0005839 | HslUV protease complex;proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0006508;GO:0051603 | proteolysis;proteolysis involved in cellular protein catabolic process | GO:0009376;GO:0097014;GO:0005737;GO:0042645;GO:0005739;GO:0031981 | HslUV protease complex;ciliary plasm;cytoplasm;mitochondrial nucleoid;mitochondrion;nuclear lumen | GO:0004176 | ATP-dependent peptidase activity | GO:0033955;GO:0006264;GO:0070581 | mitochondrial DNA inheritance;mitochondrial DNA replication;rolling circle DNA replication | 3.4.25.2 (HslU--HslV peptidase) | 3.4.25.2 (HslU--HslV peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.3990ORATP-dependent protease subunit HslV, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.3990 OR ATP-dependent protease subunit HslV, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.4030 | LmxM.36.4030.1 | 1 | 1 | 1 | | | forward | protein coding | No | 3801 | LmxM.36.4030 | metallo-peptidase, Clan MC, Family M14, putative | metallo-peptidase, Clan MC, Family M14, putative | | E9ATI6 | 20 | LmxM.20:1,516,710..1,520,510(+) | LmxM.20:1516710..1520510(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 50 | OG6_142418 | 0 | 1266 | 3801 | 136669 | 8.98 | 0 | | | | | GO:0004181;GO:0008270 | metallocarboxypeptidase activity;zinc ion binding | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.4030ORmetallo-peptidase, Clan MC, Family M14, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.4030 OR metallo-peptidase, Clan MC, Family M14, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.4300 | LmxM.36.4300.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2250 | LmxM.36.4300 | trypanothione synthetase-like protein | trypanothione synthetase-like protein | | E9ATL4 | 20 | LmxM.20:1,635,872..1,638,121(+) | LmxM.20:1635872..1638121(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 36 | OG6_173844 | 0 | 749 | 2250 | 82726 | 5.67 | 0 | | | | | | | | | | | | | | | 6.3.1.9 (Trypanothione synthase) | 6.3.1.9 (Trypanothione synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.4300ORtrypanothione synthetase-like proteinANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.4300 OR trypanothione synthetase-like protein AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.4360 | LmxM.36.4360.1 | 1 | 1 | 1 | | | forward | protein coding | No | 1230 | LmxM.36.4360 | Regulatory particle triple-A ATPase subunit 6 | Regulatory particle triple-A ATPase subunit 6 | | E9ATM0 | 20 | LmxM.20:1,667,236..1,668,465(+) | LmxM.20:1667236..1668465(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 51 | OG6_101513 | 0 | 409 | 1230 | 45572 | 9.45 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | GO:0005737;GO:0005654;GO:0005838 | cytoplasm;nucleoplasm;proteasome regulatory particle | GO:0016887 | ATPase activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.4360ORRegulatory particle triple-A ATPase subunit 6ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.4360 OR Regulatory particle triple-A ATPase subunit 6 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.4450 | LmxM.36.4450.1 | 1 | 1 | 1 | | | forward | protein coding | No | 2031 | LmxM.36.4450 | mitochondrial intermediate peptidase, putative | mitochondrial intermediate peptidase, putative | | E9ATM9 | 20 | LmxM.20:1,701,374..1,703,404(+) | LmxM.20:1701374..1703404(+) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_102110 | 0 | 676 | 2031 | 75893 | 6.30 | 0 | NN: MLRRLVSCASPLRLRGCGAA, HMM: MLRRLVSCASPLRLRGCGAA | NN Sum: 1, NN D: .41, HMM Prob: .86 | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.4450ORmitochondrial intermediate peptidase, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.4450 OR mitochondrial intermediate peptidase, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.5560 | LmxM.36.5560.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2466 | LmxM.36.5560 | metallo-peptidase, Clan MG, Family M24 | metallo-peptidase, Clan MG, Family M24 | | E9ATZ1 | 20 | LmxM.20:2,118,902..2,121,367(-) | LmxM.20:2118902..2121367(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 27 | OG6_200380 | 0 | 821 | 2466 | 88846 | 7.38 | 0 | NN: MLRRAWRTAPVQRLSVSVTLGLARWIGGATAV, HMM: MLRRAWRTAPVQRLSVSVTLGLARWIGGATAV | NN Sum: 4, NN D: .61, HMM Prob: 1 | | | GO:0004177;GO:0030145 | aminopeptidase activity;manganese ion binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.5560ORmetallo-peptidase, Clan MG, Family M24ANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.5560 OR metallo-peptidase, Clan MG, Family M24 AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.6020 | LmxM.36.6020.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 807 | LmxM.36.6020 | OTU-like cysteine protease, putative | OTU-like cysteine protease, putative | | E9AU37 | 20 | LmxM.20:2,277,560..2,278,366(-) | LmxM.20:2277560..2278366(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 49 | OG6_102949 | 0 | 268 | 807 | 29921 | 6.52 | 0 | | | | | | | | | GO:0097014;GO:0005737;GO:0031981 | ciliary plasm;cytoplasm;nuclear lumen | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.6020OROTU-like cysteine protease, putativeANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.6020 OR OTU-like cysteine protease, putative AND Leishmania mexicana MHOM/GT/2001/U1103 |
|
LmxM.36.6750 | LmxM.36.6750.1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2094 | LmxM.36.6750 | prolyl endopeptidase | prolyl endopeptidase | | E9AUB0 | 20 | LmxM.20:2,552,846..2,554,939(-) | LmxM.20:2552846..2554939(-) | LmxM.20 | Leishmania mexicana MHOM/GT/2001/U1103 | 64 | OG6_101804 | 0 | 697 | 2094 | 77931 | 5.83 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | GO:0005737 | cytoplasm | GO:0070012 | oligopeptidase activity | | | 3.4.21.26 (Prolyl oligopeptidase) | 3.4.21.26 (Prolyl oligopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=LmxM.36.6750ORprolyl endopeptidaseANDLeishmania mexicana MHOM/GT/2001/U1103 | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=LmxM.36.6750 OR prolyl endopeptidase AND Leishmania mexicana MHOM/GT/2001/U1103 |
